SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017199591.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017199591.1.1745
Domain Number 1 Region: 324-614
Classification Level Classification E-value
Superfamily Kelch motif 4.18e-77
Family Kelch motif 0.0000844
Further Details:      
 
Domain Number 2 Region: 8-62,119-183
Classification Level Classification E-value
Superfamily POZ domain 1.49e-28
Family BTB/POZ domain 0.005
Further Details:      
 
Weak hits

Sequence:  XP_017199591.1.1745
Domain Number - Region: 74-108
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00102
Family beta-sandwich domain of Sec23/24 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017199591.1.1745
Sequence length 630
Comment PREDICTED: kelch-like protein 14 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MSRSGDRTSTFDPSHSDNLLHGLNLLWRKQLFCDVTLTAQGQQFHCHKAVLASCSQYFRS
LFSSHPPLGGGGVGGQDGLGAPKDQQQPPPQQQQPQQQPPPPQEEPGTPSSSPDDKLLTS
PRAINNLVLQGCSSIGLRLVLEYLYTANVTLSLDTVEEVLSVSKILHIPQVTKLCVQFLN
DQISVQNYKQVCKIAALHGLEETKKLANKYLVEDVLLLNFEEMRALLDSLPPPVESELAL
FQMSVLWLEHDRETRMQYAPDLMKRLRFALIPAPELVERVQSVDFMRTDPVCQKLLLDAM
NYHLMPFRQHCRQSLASRIRSNKKMLLLVGGLPPGPDRLPSNLVQYYDDEKKTWKILTIM
PYNSAHHCVVEVENFLFVLGGEDQWNPNGKHSTNFVSRYDPRFNSWIQLPPMQERRASFY
ACRLDKHLYVIGGRNETGYLSSVECYNLETNEWRYVSSLPQPLAAHAGAVHNGKIYISGG
VHNGEYVPWLYCYDPVMDVWARKQDMNTKRAIHTLAVMNDRLYAIGGNHLKGFSHLDVML
VECYDPKGDQWNILQTPILEGRSGPGCAVLDDSIYLVGGYSWSMGAYKSSTICYCPEKGT
WTELEGDVAEPLAGPACATVILPACVPYNK
Download sequence
Identical sequences G1SVG1
9986.ENSOCUP00000007417 ENSOCUP00000007417 XP_017199591.1.1745 ENSOCUP00000020548

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]