SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017203201.1.1745 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017203201.1.1745
Domain Number 1 Region: 129-207
Classification Level Classification E-value
Superfamily DEATH domain 0.000000412
Family DEATH domain, DD 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017203201.1.1745
Sequence length 216
Comment PREDICTED: ectodysplasin-A receptor-associated adapter protein isoform X1 [Oryctolagus cuniculus]; AA=GCF_000003625.3; RF=representative genome; TAX=9986; STAX=9986; NAME=Oryctolagus cuniculus; breed=Thorbecke inbred; AL=Chromosome; RT=Major
Sequence
MGLRTTKQMGRGTKQPAGHQEDHMAKEPVEDTDPSTLSFNMSDKYPIQDTGLPKAEECDT
VTLNCPPNSDEQHQGEENGFPDSTGDPLSDVSKDKPCHENCTCSSCSLRAPTISDLLNDQ
DLLDVIRIKLDPCHPTVKNWRNFASKWGMPYDELCFLEQRPQSPTLEFLLRNSQRTVGQL
MELCRLYHRADVEKVLRRWVEEEWPKRERGDYSRHF
Download sequence
Identical sequences G1TYE5
9986.ENSOCUP00000022109 XP_017203201.1.1745 ENSOCUP00000022109 ENSOCUP00000022109

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]