SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017207612.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017207612.1.45394
Domain Number 1 Region: 5-289
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 3.98e-76
Family BAR domain 0.0014
Further Details:      
 
Domain Number 2 Region: 397-574
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 6.47e-50
Family BCR-homology GTPase activation domain (BH-domain) 0.00000157
Further Details:      
 
Domain Number 3 Region: 263-370
Classification Level Classification E-value
Superfamily PH domain-like 5.58e-17
Family Pleckstrin-homology domain (PH domain) 0.019
Further Details:      
 
Domain Number 4 Region: 807-862
Classification Level Classification E-value
Superfamily SH3-domain 0.00000000000354
Family SH3-domain 0.00017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017207612.1.45394
Sequence length 863
Comment rho GTPase-activating protein 42 isoform X4 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MGLPTLEFSDSFVDSPDFRERLKCHEIELDRTNKFIKELIKDGHQLICALKNLSAAVQKF
SQSLQEFQFECIGDAETDDEVNIAQSFKEFSKLLHTMEEERRRLIQNADDVLITPLERFR
KEQIGAAKEGKKKFDKEAEKYYSTLDKHLNLSSRKKESALQEADAQIDRERQLFYDASLE
YVFKIQDVQEKKKFEFVEPLLAFLQGLFTFYHEGYELAHDFEPYKQQLQFNLQNTRNNFL
STKQEVENLMNRVRSADQDQKPPGQWTMEGYLYVQEKRPLGCTWTRHYCTYDKDNQTFSM
CNTEAKPAAKQNGVTSNPPEKFRLKSCIRRKTDSIDKRFCFDIEVVERHGIITLQALSES
NRRLWLEAMDGKEPIYNLPAILSKKEETYLNETGFNFVRKCIQLVEVRGLNTMGLYRVGG
INSKVQKLMTTVFSPKAASDLDLDPDTWDNKTITSGLKNYLRCLSEPLMTYKLHSDFLMA
VKSDDQNYRVCAVHALVHKLPDKNREMLEILIKHLLNVSSHSESNMMTVSNLGVIFGPTL
MRSQEETVAAMMNIKFQNIVVEILIENLEKIFHQAPDPNVPLLQPLSRPESRRSRAIGLT
SGPRKPRSLYTPSLCLADADSDTFSSSSGSTPIGSMDSLSSHSSEQNSSSKTCSSPQHKD
KPPFPGPRSPFSRSSSEPQGPAGTSSPDSSSREQDCPADESFRGNIRSTTAPTKAPHAQL
NRSIAQSLRSLHLTEGVCKSFAGSVHSLACVDGSKSTTCLDLPPKALLRRKLDNNSSTNG
YQRPGSVVAARALLFENPSAVKHPPLGRDAKAIYSCEAEHSNELSFPQGAHFSNVYPSVE
PGWLQATFEGKTGLIPENYVVFL
Download sequence
Identical sequences XP_017207612.1.45394 ENSDARP00000009077 ENSDARP00000009077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]