SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017212747.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017212747.1.45394
Domain Number 1 Region: 180-411
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.07e-57
Family Voltage-gated potassium channels 0.00088
Further Details:      
 
Domain Number 2 Region: 39-143
Classification Level Classification E-value
Superfamily POZ domain 4.04e-32
Family Tetramerization domain of potassium channels 0.00000412
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017212747.1.45394
Sequence length 632
Comment potassium voltage-gated channel subfamily D member 1 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MAAGVATWLPFARAAAVGWLPLAKKTMPKPPIDKKNRNDEILFVNVSGLRFQTWKNTLDR
YPDTLLGSSEKEFFYNEDTQEYFFDRDPEMFRHILNFYRTGRLHYPRQECIQAFDEELAF
YGIVPDIIGDCCMEEYRDRKKENQERLAVDTEAEMATDTPLPPHSTHRERLWRAFENPHT
STMALVFYYVTGFFIAVSVIANVVETVPCRPLKGSKKDLPCGEKYSLAFFCMDTACVLIF
TFEYLMRLFAAPSRCKFMRSVMSVIDVVAIMPYYIGLVMPENEDVSGAFVTLRVFRVFRI
FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGTKGTNFTSIPAS
FWYTIVTMTTLGYGDMVPNTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD
KMRAQQKVRLARIRLAKKGTTNAFLQYKEEGGFHDRDHDGALCLKNRSSFEHQHHHLLHC
LEKTTNHEFTDELTFSEMCMTESVGYRTSRSTSISSQQGVSTSCCPRRAKRRAIRLANST
VSVSRGSVQELDTLHVHKTTIRPQSRSSLNARTEDLKLNCDDRDFTAAIISIPTPPANTP
DESLPPSPAIPGILRNSRSSSFTHETVKISSL
Download sequence
Identical sequences B0UYF4
7955.ENSDARP00000098413 ENSDARP00000098413 ENSDARP00000098413 ENSDARP00000120299 NP_001119942.1.45394 XP_005166764.1.45394 XP_017212747.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]