SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017212817.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_017212817.1.45394
Domain Number - Region: 209-252
Classification Level Classification E-value
Superfamily Tudor/PWWP/MBT 0.0963
Family Tudor domain 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017212817.1.45394
Sequence length 257
Comment uncharacterized protein LOC550562 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MESPYRTHRSKHTGVRSVSSGRSTMKKKNSHKNRHARAVSPVRPLGQSVVGCRIQHLWKE
DVSSPVSLWKGTVLSQVEVDDSLFLIKYDGVDCVYGLQLFTDDRVRDLELQPGQIASFRV
SDSRLADRLLGRPVVHLFETDDGSKDEWKGLVLSRAPSMPAWFFITYEKDPMLYMYQLMQ
DYRDGDLRLLPDSDEAAELREAGEVSETLVGKQVECLNKDGAQKLGTIIQQVQAKPSVYF
IKFNDDYHIYVYDMVGS
Download sequence
Identical sequences F1R8A6
ENSDARP00000051773 ENSDARP00000051773 XP_017212817.1.45394

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]