SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017214657.1.45394 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017214657.1.45394
Domain Number 1 Region: 18-168
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 9.51e-21
Family Synaptotagmin-like (S variant) 0.062
Further Details:      
 
Domain Number 2 Region: 1239-1266
Classification Level Classification E-value
Superfamily Eferin C-derminal domain-like 0.00000000301
Family Eferin C-derminal domain-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017214657.1.45394
Sequence length 1271
Comment uncharacterized protein LOC570939 isoform X1 [Danio rerio]; AA=GCF_000002035.6; RF=reference genome; TAX=7955; STAX=7955; NAME=Danio rerio; AL=Chromosome; RT=Major
Sequence
MPLISLDDEEQRWVPTHVNVTVLRARALRTKGKQGSRYVYTIIQVGKEKYTTGLVEKAEE
PQWGEECAFELLPGLLEAGGTSAYPPGSSNLVFTVMHRVLIGLDVFLGQTIVPLDKVFQE
GTCPRNEWLKLHSKAGRKEKERGELQVTIQFTRNNMTASMYDLTVKDKPRSAFGKLKDRV
TGKKRDVESSSAVLPGRYAALSGSVGPPFAGDGGSYEASEEDGVEEHRSKVKDFFLKGKL
RKNSDTRSCSSLASDSSMASSAGDPFIPVEIPRTPIYSSRVMEPFRMDTEEAIKVMTHKR
AHSDEASKITCVPRPSPAVENLSQSTLCINGSHIYSSEPVSPKSPSAIPAKRSLLEKCAP
LSRSLQNLTRRGEDSQKSDGRRWSIDKSKKEDLETNAAQSQTQGSTIVDGKPVQAAGAVD
VLDKGKKLRKTLFSSGRSDSLPAKPEQGQVSAPVEGRRRGWFGSGDSQNKPRLGVSPKVE
SSSELPCQIPCSPSQPPCSLPLGCTTGSVSPPSGNPFTPSSPTPPSISPSNPFLTRLQQN
PFFEELIAEEALKSPTAGYCSLNSSLYHPVSRSSVLRNGAQNRIPTIKRERPRSMSRQRS
LPTIMPETPDTNSNGNPNHCLSERVGDWDDFEAFASSRLKSPSGTPTRPPSAPFPNTNLM
ECVNDTTIGLRVDEVDMGVSRQWDLPPLPPRRPIRTQVVSTDSWLDRAQEMAVQKEACFL
SQTDFASLQHVRDGDVKRNSQTVCSDKVLHNFSSVENNNMELQSGIKLSEYIGEPTGQDF
ATNNNANTSPNGFVEDALGSSECEYTVPETLCFPSDWETTVAESLCSSPQTQPKQDSELS
FEGKVSDEQQCKSKTNDVNLLTLSPRDSNNNTDVTSEFAFIDSESSPSELQPFEIKNGSK
ECSNVHFGSGSSLPRCSPGIPEDILSKMASELDMFSPKNALCSSPYERSCEGLGEQKANS
CENQNCDVDVLLNNDNTVTNPKMSESDCILHTTHNNEEHKVLDSENKLEPEVSLSTDNKI
QEYTSTSEQQISFEDLHARVAPRNSRSPCKMEVRSARIRPRSTTSSPKNVQGADQLPDSH
TPTSNLSLHDPTPSPSQLLDTNSCLHSDPSLPANPQNERPSMGSTRSTTIQPHEESSPHP
VKPLTNNTLQGEKKAESRSVLEKLKSTINPGRSALATTAEEEKQQLSLMEARAHYQNMTN
MELIALLLQQELEIKKQRAETEVQVVMLEKRDAELKKMKVQVRDLEDYIDKLLVRIMEQT
PTLLQVRGRLK
Download sequence
Identical sequences XP_017214657.1.45394 ENSDARP00000104916 ENSDARP00000104916

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]