SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017265153.1.84151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017265153.1.84151
Domain Number 1 Region: 30-515
Classification Level Classification E-value
Superfamily Sema domain 1.44e-101
Family Sema domain 0.00081
Further Details:      
 
Domain Number 2 Region: 1391-1516,1682-1866
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 3.49e-34
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 859-954
Classification Level Classification E-value
Superfamily E set domains 0.000000000000751
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 1048-1126
Classification Level Classification E-value
Superfamily E set domains 0.00000000000382
Family E-set domains of sugar-utilizing enzymes 0.085
Further Details:      
 
Domain Number 5 Region: 954-1027
Classification Level Classification E-value
Superfamily E set domains 0.0000000000878
Family Other IPT/TIG domains 0.048
Further Details:      
 
Domain Number 6 Region: 513-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000331
Family Plexin repeat 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017265153.1.84151
Sequence length 1906
Comment PREDICTED: plexin-D1 [Kryptolebias marmoratus]; AA=GCF_001649575.1; RF=representative genome; TAX=37003; STAX=37003; NAME=Kryptolebias marmoratus; AL=Scaffold; RT=Major
Sequence
MPPSCMEIAVLLLGVLALETRRSASALHIQQAFASPNHTNNFAVDPVSGNVYLATVNTIY
QLNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNYNKLLKLDRDQGVVVVCG
SVYQGFCELRRMGNISEIAVEFPPQGEKTVFPSMLNIAANHPNASTVGLIFKSHGGSTRL
LVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNLKDLSRLFTYDINPSEDNVFKIK
QEVKAKNKLNFVHAFTQKTYSYIAFNNDAKMGHKESQPNSILSRICLDTETPRKPTGPES
KKLTESYIQMPLQCGQSGNIYNRLLSVYPAEIRAAGDGRGPEPYLFGVFSKVDRKSALCA
FRFRDVEEEIRQGRKNCSNSPSSDVQVLDSVIQGSGAACVQKGNLVLQPEQLDCGAAHLQ
HPLALRRPLRAVPLFEYPSLTSVSVDSVHDHTVVFLGTSNGRLRKLTLLANMTLANQRTL
KLPASEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVAQCDQWKSCRDCLGAGDAHCGWCTL
ENRCTIQKECARELLARSWIPVGEGPQQCPSITLTPPEISISADIKDVGILINGSVPNLI
GSRVECEYRPGVSTAATLHLDYGPAQIQTCPLLPREHFQPIPPGTDHLTLSVAIKVNGTS
VVSGSFIIYDCERTGAIHPKTSCVSCLSTKWKCYWDQEKHLCLANKEHSKDPIESATLCP
SLIASEVPPSPSGEAQDFTLSLSNIREREKLDCDFGTEQRYEAIWLDDSTVNCTGVTLST
SQRSQVYHLNLRRRGYFISQRGDIFLDSPQPMKVEVYNCGVGSSDCSQCWGREDQRHLCG
WCENSCRLKKDCQSIGDQCPAPEIHKISPLRGPAEGGTLLTVQGRNLGRRPAGVQISIGN
IPCDLLPERYTVSVKLVCRTGRSARDRMEFVQVDVDQDGGTPKTGTSKEKFSYLVPKLKS
IEPERGSRIGGTRVTLSGEHLDIGSKVRVKVNSTLECNITEKTDETIECIMPPALQAHAD
LVTVCVEFEGHPCEGSESELDIPYTYEKNPTIDSIHPKKSFLSGGRTITVTGQGFDLVQS
VVMEVQGIGSTPCGIVSSSTITCLSPAASQSQGTSVQFILNNIIYTRDSPSSSDNEPEEE
NGEPHKSSFLLDYVEDPQFYTANKEKLIKHHSGEPLTLIINKVPSDLELLPEEYSVMIGP
YPCNISFHNDQLFHCTINGLLSSSESEMPVTVQVGNFHKSIARVQLGGSELAIVVSIVVC
CVLLLLCTVALVVYCTKSRRAERYWQKTIVQMEEMESQIREEIRKGFAELQTDMTDLTKE
LNRSQGIPFLEYKQFVTRTFFPKMCSDYETSLVQPTYENDSLGPRALPETHPLLQDWQAT
NTTRPNVEEGITMFSTLLNNKHFLVTFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYY
TSIMKDLLVDLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLC
AIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDT
ICQVKEKILEAFYKNLPFSQWPRAEDVELEWFDSGSNSKLLQDLDNSSVMEDSRKKLNTI
FHYQVPEGASLAMSMKDKKENTLERVKDLDTEKYVHLVLPHDELIETKKSHRHSHRKKVL
PEIYLTRLLSTKGTLQKFLDDLFQAILSIPPDRPPLAVKYFFDFLEEQADKRGITDPDTL
HIWKTNSLPLRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPT
NKLLYAKEIPEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYK
YAKRYRNQVVNALEANPTARRTQLHHKFDQVVALMEDNIYECCSEA
Download sequence
Identical sequences XP_017265153.1.84151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]