SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017269853.1.84151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017269853.1.84151
Domain Number 1 Region: 218-395
Classification Level Classification E-value
Superfamily MIR domain 7.19e-47
Family MIR domain 0.0017
Further Details:      
 
Domain Number 2 Region: 1077-1169
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000000121
Family SPRY domain 0.074
Further Details:      
 
Domain Number 3 Region: 647-801
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000174
Family SPRY domain 0.052
Further Details:      
 
Domain Number 4 Region: 3919-3997
Classification Level Classification E-value
Superfamily EF-hand 0.000000758
Family Calmodulin-like 0.036
Further Details:      
 
Domain Number 5 Region: 2074-2140
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000262
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 
Domain Number 6 Region: 436-547
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000327
Family IP3 receptor type 1 binding core, domain 2 0.017
Further Details:      
 
Domain Number 7 Region: 102-183
Classification Level Classification E-value
Superfamily MIR domain 0.0000458
Family MIR domain 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017269853.1.84151
Sequence length 4879
Comment PREDICTED: ryanodine receptor 3-like isoform X8 [Kryptolebias marmoratus]; AA=GCF_001649575.1; RF=representative genome; TAX=37003; STAX=37003; NAME=Kryptolebias marmoratus; AL=Scaffold; RT=Major
Sequence
MAEGGEGEDEIQFLRTDDEVVLQCVACIQKENRKFCLAAEGLGNRLCYLEPTSEAKYVPP
DLCICTFVLEQSLSVRALQEMLAKSGQNREGAAQSGGHKTLLYGHAILLRHSFSSMYLAC
LKTSRSQTDKLSFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYL
HLSISNGNIQVDASFMQTLWNVHPICSGSNIEEGYLLGGHVMRLFHGHDEVVSIPGSDQS
EEQQRIVNYETGKAGAKARSLWRLEPLRISWSGSHIRWGQPFRLRHLTTGHYLALTEDRG
LVLQDRERSDTVSTAFCFRASKEKLEQSPKRDIEGMGVAEIKYGDSLCFIMHVATGLWLS
YQAPDVKSARLGPLKRRACLHSEGHMDDGLTLQRCQHEESRAARIIRNTTLLFKRFIRDL
DCLSAKNRAMVALPVEEVLQTLNDLITYFQLPDAELEHEEKQIKLRSLKNRQNLFKQEGM
LTLVSNCIDRLNVYNSAAHFGECAGSEAGAAWKDILNLLYELLAALIRGNRNNCTQFSNN
LDWLVSKLERLESSSGILEVLHCILIESPEALNIIQKGHIKSIISLLYKHGRNHKILDVL
CSLCVCNGVAVRTNQNLICDHLLPKRDLLLQTQLVNDVQSMRPNIFLGVSEGSAQYKKWY
YELMIDQVDHFVTSEPSHLRVGWANTKGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWS
GRIPRAVASVNQHILTSEDVVSCCLDLGAPSISFRINGQPVQGMFENFNTDGLFFPIVSF
SAGVKVRFLLGGRHGDFKFLPPSSYAPCYEALLPKEKMKVEPVKEYKRDVEGVRDLLGNP
QFASQASFIPIPVETSQIVMPPHLEKIRDKLAENIHELWGMNKIELGWTYGKIRDDNKRQ
HPCLVDFSKLPETEKNYNLQMSTETLKTLLALGCRIVQVNPNAEDSLKKIKLPKNYMMSN
GYKPSPLDLSDIKLTPGQELLVDKLAENAHNVWAKDRIKQGWTYGIQQDLKSKRNPRLVP
YALLDERTKKSNRDSLREAIRTMIGYGYNIEPSDQEGGQTVERLSIDKIRFFRVERTYAV
KTGKWYFEFEAVTGGDMRVGWARPGCKPDVELGTDELAFVFDGYRGHCLNMGSRLFGRCW
HAGDVVSCMINMEDKSIIFTLNGEILITTKGSELCFTDFEAEDGFIPVCSLGLAQVGRMN
LGKDASSFKYYTTCGLQEGFEPFAVNMNREVTMWFSKRLPTFVNVPKNHNHIAVTRIDGT
IDSPPCLKVTHKTFGTQNSNADMVFCRLSMPVEFHSFFKSSPAVDMNGVHEEELLKVKHR
YPLRSVRHIEETRRVDYSSITSYHHSVRIFAGQDPTCVWVGWVTPDYHYYSNNYNLGKNR
TVTVTLGDERGRVHESVKRSNCYMVWGGDVIGAGHASGGSNVDLEIGCLIDLATGLVTFT
ANGKEISTSYQVEPHTKLFPAVFVRPTSPNLFQFELAKIKNAMPLSSAIFKSEHKNPVPQ
CPPRLDVQTINAVLWSRMPNIFLKVETARVSERHGWVVQCVEPLQMLAVHIPEENRCVDI
MELSEQEDMRKFHYHTLKLYCALCALGNTRVAHALCSHLDQSQLLYTIDNQYLSGMLREG
FYNVLISIHLETAKEARLMMKDEFIIPVTAETRSIRLFSDASKKHSLPGVGLSTSLKPRL
NFTPPCFISTKREHLYSPQMPLDVLKEKAISMLTEAVHGGGHHIRDPVGGGVEYQFVPIL
KLISTLLTMGVLGSEDVQKILLLIDPNVFRETRKGVVTGHIDKEGLKGTEGKAVEAGEEE
AAKEAKQLMEGLLEKSLPEPVKRQMCELLHYFCDCELKHRIEAIVSFSDSFVSKLQYNQK
FRYNELMLALNMSAAVTAKKTKEFRSPPQEQINMLLTFSMGDDCPCPVDIQEELYDFHNQ
LQLHCGIPMEEDDDERDTSIKGRLLMLVNKIKSQSQKAQEPKEKKQAAPSNLKELISQTM
VSWSQECHIQDPKLVRKMFSLLRRQYDSIGELLRAMRKTYTISAASVQDTINLLASLGQI
RSLLSVRMGKEEEKLMIDGLSDIMNNKVFYQHPNLMRILGMHETVMQVMVNVLGGDKSQE
IAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPSMRGSTPLDVAASS
VMDNNGLALALEEPDLDKVVTYLAGCGLQSCLMLLAKGYPDIGWNPIEGERYLSFLRFAV
FVNGESVEENSSVVVKLLIRRPECFGPALRGEGGNGLLAAMKEAIKISETPALDLPGSVH
RVSSDLSADGDDEEEVVHMGNAIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILRS
LVPTEDLVGIISIPLKMPVINKDGSVTEPDMSATFCPDHKAPMVLFLDRVYGIEDQSFLL
HLLEVGFLPDLRAATSMDTEGLCTTETALAMNRYIGSAMLPLLTRCAPLFAGTEHYATLI
DSTLHTIYRLSKGRSLTKAQRDAIEECLLSICKHLRPSMLQQLLRRLVFDVPLLTEYCKM
PLRLLTNHYEQNWKYYCLPSGWGSFGTASEDELLLTKRIFWGVFDSLSQRKYEPELFKMA
MPCLSAIAGALPPDYVDASISTTLEKPVSVDAQGNFDPKPINIANVVLPEKLEHFANKYS
EHCHEKWSAEKVLLGWKYGDCVDEKAKTHPQLRTYKALTEKEKEIYRLPIRDSLKSMLVM
GWSVDRTKDGESMSQQRENEKMRKISQASQASGFNPSPIDTSNVVLSRELQGMVEVMAEN
YHNIWAKKKKSDLGSRGGGTHPLLVPYDTLTAKEKARDREKAQDLFRFLQINGYSITRGL
KDLEQDSSSMEKRFAYKFLKKLLKYVDSAQEFIAHLEAMAASGKTDRSPHEQEIKFFAKV
LLPLIDQYFKNHSLYFLSSPNKNLSSSGYASNKEKEMVTSLFCKLAALVRHRISLFGSDS
TTMVSCLHILAHTLDTRTVMKSGSEQVRVGLRMFFENAAEDLEKTFENLKLGKFTHSRSQ
MKGVSQNINYTTVALLPILTALFEHITQHHFGVNLLLDDVQVSCYRILTSLYALGTGKNI
YVERQLPALGQCLATLAGAMPVAFLEPKLNTYNPCSVFNTKSVRDRAVLGIQESVEEMCP
GMPRLDGLMKDINDMAESGARYTEMPHVIEVVLPMLCNYLSYWWERGPENQPASGSSICC
TTVTSEHLSLILGNILKILNNNLGIDEASWMKRIAVYVQPIIGKARADLLKSHFLPTLEK
LKKKTVKVVAEEELLKADCKGDTQEAELLILDEFAILCRDLYAFYPMLIRYVDNNRSRWL
KEPDTDSNELFRMVAEIFILWCKSHNFKREEQNFVVQNEINNLSFLTGDNKTKMSKSGGQ
DQERKHKKRRGEFYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKTRYLMKDTDEEV
KDHIHQNLHLRERSEDPAVRWQLNLYKDIVMRTECSPDPERVVDRIQRISAAIFNLEQVE
QPLRSKKCVWQKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLLAYQSIWIETEEYSFE
EKLVQDLAKTQPKVEEEEEEEIRKQPDPLHQLILHFSHNALTECSSVSEDPLYIAYADMM
AKSCAEGEEEEGGKEKTFEEKEMEKQKMLYQQARLHDRGAAEMVLQMISASKGRLGATVT
FTLKLGISVLNGGNILVQQKMLDYLKEKRDVGFFKSLSGLMMSCSVLDLNAFERQNKAEG
LGMVTEEGSINVSERGSKVLQNDEFTKDLFRFLQLLCEGHNNDFQNFLRTQTGNTTTVNI
IISTVDYLLRLQESISDFYWYYSGKDIIDEAGQRNFSKALAVAKQVFNSLTEYIQGPCIG
NQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIELLKELLDLQQDMIVMMLSLLEGNV
VNGTIGKQMVDTLVESSSNVEMILKFFDMFLKLKDLTTSDSFKEYDSESKGVISKKDFQK
SMENQKQYSQSEIEFLLSCAEADENDMFSYKQFVERFHEPAKDIGFNVAVLLTNLSEHMP
HDARLSTFLDLAESVLSYFEPFLGRIEIMGGAKRIERVYFEISESSRTQWEKPQVKESKR
QFIFDVVNEGGESEKMELFVNFCEDTIFEMQLASQISEPDPVEHPDEDEDESQNVVEDQE
EEEEESVMMESSSAFTIACISMRKSLCNFRQLLTLKSMRRQYRKFRKMSVREMVRGFFSF
FWMIITGLFHFVYNLVWGFFHILWTTLFGGGLVEGAKNMKVTDILGNMPDPTQFGIHGDV
LETEKMEANEALALEEMGQMAQGDAAEADLMAELLNIQPKREGKHGTEPGLGDVSEVVVG
DAPSIASAVKQKKAQLAAKKRAVNGDYKSDSEKGDSEDGEKKDHDKAKDEAPPEPSMEEK
RAPKKRLGLRKEPPEAFMASFFAGLEIYQTKMLNYLARNFYNLRFLALFVAFAINFILLF
YKVTGDYPEDEDPWSRRGRAGEEEEDEGALECFVLQESTGYMAPTLCCLAILHTIISFLC
VVGYYYLKVPLVVFKREKEIARKLEFAGLYITEQPSDDDIKGQWDRLVINTPSFPNNYWD
KFVKRKVIKKYGDLYGAERIAELLGLDKSALDFNPTEETVAKEASLVSWLSSVDTKYHIW
KMGVVFTDNSFLYLVWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLV
LTVGLLAVVVYLYTVVAFNFFRKFYNKSVDDDEPDMKCDDMMTCYLFHMYVGVRAGGGIG
DEIEDPAGDPYELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKC
FICGIGNDYFDTTPHGFETHTLQEHNLANYLFFLMYLINKDETEHTGQESYVWKMYQERC
WDFFPAGDCFRKQYEDQLG
Download sequence
Identical sequences XP_017269853.1.84151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]