SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017272346.1.84151 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017272346.1.84151
Domain Number 1 Region: 454-589
Classification Level Classification E-value
Superfamily TIMP-like 5.18e-26
Family Netrin-like domain (NTR/C345C module) 0.022
Further Details:      
 
Domain Number 2 Region: 229-325
Classification Level Classification E-value
Superfamily Immunoglobulin 3.55e-19
Family I set domains 0.016
Further Details:      
 
Domain Number 3 Region: 408-461
Classification Level Classification E-value
Superfamily BPTI-like 3.41e-18
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.0036
Further Details:      
 
Domain Number 4 Region: 343-402
Classification Level Classification E-value
Superfamily BPTI-like 0.0000000000000653
Family Small Kunitz-type inhibitors & BPTI-like toxins 0.014
Further Details:      
 
Domain Number 5 Region: 147-197
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000568
Family Ovomucoid domain III-like 0.031
Further Details:      
 
Domain Number 6 Region: 55-101
Classification Level Classification E-value
Superfamily Elafin-like 0.00000119
Family Elafin-like 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017272346.1.84151
Sequence length 591
Comment PREDICTED: WAP, Kazal, immunoglobulin, Kunitz and NTR domain-containing protein 1 [Kryptolebias marmoratus]; AA=GCF_001649575.1; RF=representative genome; TAX=37003; STAX=37003; NAME=Kryptolebias marmoratus; AL=Scaffold; RT=Major
Sequence
MCEIPLRPLEDKHPVWHSATCPNKPLTGWTHACFLVLLVGDFLEFSLCASVAGSRVEHEG
FCPNKLNSNLWVDAQSTCERECSVDEDCADFEKCCTNVCGLNSCVAARFSDGTPAQPDGT
GGGNGDGAPASTATCEGFICSQQGATCDIWDGQPVCKCRDRCEKEPNFTCASDGLTYFNR
CYMDAEACIRGVTLTVIPCRFYLAGPHTSPIPQDTTVNPTPTSSQEDPMPPTLYSNPHHQ
SIYVGGTVSFHCDVIGAPRPDVTWEKQSDRRERLVMKPDQMYGNVVITNIGQLVVYNAQV
WDTGIYTCIARNSAGVLRADYPLSVIRRADDDFSEDPEMPMGRPFSPADCLAEVDLRVCS
GEQHVDWFYDSKLGSCVTFNNGGCDDSRNRFETYEECKASCQREGMGVCALPAVQGPCKN
WEARWAWNSLMKQCQAFAYGGCHGNDNNFHTKKECEANCPQAKRRPCRTCRMRGKMMPSL
CRSDFAIIGRLTELVEDLDSGLARFSLEEVLRDEKMGLTFFSTKNLEVTIPKIDWSCPCP
NITIEENPLLVMGTVQDGMAIIQSDSYVKAITERRLKKLRDAINKKSCEAL
Download sequence
Identical sequences XP_017272346.1.84151

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]