SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017323336.1.5077 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017323336.1.5077
Domain Number 1 Region: 32-514
Classification Level Classification E-value
Superfamily Sema domain 2.35e-97
Family Sema domain 0.00089
Further Details:      
 
Domain Number 2 Region: 1375-1501,1668-1820
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-34
Family p120GAP domain-like 0.025
Further Details:      
 
Domain Number 3 Region: 853-946
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000021
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 4 Region: 943-1033
Classification Level Classification E-value
Superfamily E set domains 0.000000000133
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 5 Region: 517-564
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000164
Family Plexin repeat 0.0017
Further Details:      
 
Domain Number 6 Region: 1034-1111
Classification Level Classification E-value
Superfamily E set domains 0.0000000714
Family E-set domains of sugar-utilizing enzymes 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017323336.1.5077
Sequence length 1892
Comment PREDICTED: plexin-D1 [Ictalurus punctatus]; AA=GCF_001660625.1; RF=representative genome; TAX=7998; STAX=7998; NAME=Ictalurus punctatus; breed=USDA103; AL=Chromosome; RT=Major
Sequence
MPPSTESLSVASRALLVTVLLASRCVCALHVQQTFSTQSETNNFVVDAVSRRVYLAAVNA
IYQLNGTLATEVSNSTGPVRDNVLCHAPQLPQAPCEHTKYLTDNYNKLLALDREQGVLVA
CGSVYQGFCELRRMDNVSQIAVEFPKPNATVFPSMLNIVANHPNASTVGLVFRSQGGTPR
LLVAATYTGLGTEYFPKNHSKEDLRFENTPEIAIRSLNTKDLARLFTYDINPSEDNVFKI
KQEVKPKHKLSFVRVFAQKSYSYIAMNNDANSGFKESQPNSILARICLDTDTPRRQASEG
RKLTESYIQMGLQCGASGNIYNRLVSIFPADIDVQGHPAAEPYLFGVFAKSNRKSALCAF
RVAEIEETIRRGRRNCSNGPNGDVQVLDSVIQGSGAECEAKGNIVLQLEQLNCGAAHLQH
PLALRKPIRAEPLYEASGINSVAVDNIHNYTVVFLGTSNGRLRKLSLLRNLSVANQWSLR
LPAGEPVHHVMTFDPNDRNYLYLMTSHHLLRVRVSGCGQYTSCSDCLGASDAYCGWCTLE
SRCSVQQECFSGVAHSWISMGEGPQQCPSMTFTPPEFSLTAGITHVGILVNGSMPDLDGL
GLECDYGVGMATVATVHLDGGPAKIQTCPLPPSSNFPKIPLGHDHISVPVAIKVNGTSVV
SGKFVIYDCASTAEINPRTACTSCLSTKWRCYWDNQLNTCISDKDKSQGLVFENAEECPR
IITQKIPPWPTGIAQDITLRLRNVMQDTELNCDFGNGQTFEAHWVAGQLAVQCRGLTLST
VKRSETFRLDLRRRGQDKYIDTPESVTVEVYSCSGGDSDCSQCWGREQQGHLCAWCDNSC
RPRDQCQPIRDQCPDPTIHKITPLRGPLSGGTLLTVQGKNLGRRVEEVKVSIGDVSCQLL
PHHYTVSVKLVCMTGASLNEVKNKVHVKVNETAMGSSREDFSYVEPRLSDLNPIRGPIAG
GTRLTIRGASLEAGSTVKVKINSTQDCKINRLSDDIIECVMPPAVPDLAENVTVCVEYDE
RPCERLSSVFYYEKNPVISIVKPNKSYLSGGRKISVIGQSFDLVQTAKMHMVGIGQSDCK
IASPNLILCHSPPASQSQQAMAQFELNGILYRRNGHASSELDLDEEEEPNAGYFQFEYVE
DPQFYTANKEKLIKHHPGEPLTLIINKGPNELDLTRDEYSVTVGSERCEISFDNKQMFHC
TVNRTLSYSGGELSVTVRAGNFEKVIAVVQMGGSELAIIVTVVVCCVLLLLCTVALVVYC
TKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKQF
VTRTFFPKMCSDYERSLVQPVYENDALGPRALPETHPLLKDWQPSSTTRPNVEEGITMFS
TLLNNKHFLITFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKELLVDLIDAS
ASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAIT
GKARYTLNEEWLLRENIEAKPLNINVSFQGFGMDSVTVRVMNTDTICQVKEKILEAFYKN
LPYSQWPREEDVELEWFPGAGCSSRILQDLDNTSIMEDGRKKLNTVFHYQIPEGASLAMS
MKDKRENTLGRAKDLDTEKYVHLVLPHDELAETKKSHRHSHRKKVLPEIYLTRLLSTKGT
LQKFLDDLFQAVLSIPPEKPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWV
NILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYKK
RVQSYYKQIQEMAPLSEQEMNAHLAEESRKYRNDFNTNLALTEIYKYAKRYRTQVVNALD
SNPTARRTQLQHKFEQVIALVEDNIYECSSEA
Download sequence
Identical sequences A0A2D0QZZ1
XP_017323336.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]