SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017332742.1.5077 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017332742.1.5077
Domain Number 1 Region: 217-394
Classification Level Classification E-value
Superfamily MIR domain 1.7e-47
Family MIR domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1077-1166
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.52e-18
Family SPRY domain 0.043
Further Details:      
 
Domain Number 3 Region: 657-804
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000332
Family SPRY domain 0.047
Further Details:      
 
Domain Number 4 Region: 3942-4001
Classification Level Classification E-value
Superfamily EF-hand 0.000000383
Family Calmodulin-like 0.059
Further Details:      
 
Domain Number 5 Region: 100-182
Classification Level Classification E-value
Superfamily MIR domain 0.0000314
Family MIR domain 0.029
Further Details:      
 
Domain Number 6 Region: 429-546
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000353
Family IP3 receptor type 1 binding core, domain 2 0.021
Further Details:      
 
Domain Number 7 Region: 2074-2140
Classification Level Classification E-value
Superfamily IP3 receptor type 1 binding core, domain 2 0.0000497
Family IP3 receptor type 1 binding core, domain 2 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017332742.1.5077
Sequence length 4874
Comment PREDICTED: ryanodine receptor 3-like [Ictalurus punctatus]; AA=GCF_001660625.1; RF=representative genome; TAX=7998; STAX=7998; NAME=Ictalurus punctatus; breed=USDA103; AL=Chromosome; RT=Major
Sequence
MAEGGEAEDEIQFLRTDDEVVLQCVASIQKENRKFCLSAEGLGNRLCYLELTSEAKYVPP
DLCICNFVLEQSLSVRALQEMLAKTGENNEAAHGGGHRTLLYGHAILLRHSFSRMYLTCL
KTSRSLTDKLSFDVGLQEDSTGEACWWTIHPASKQRSEGEKVRIGDDLILVSVSSERYLH
LSISNGNIQVDASFMQTLWNVHPTCSGSSVEEGYLLGGHVMRLFHGHDEVLTIPGSDQSE
EQQRIVNYETGKVGAKARSLWRLEPLRISWCGSHIRWGQPFRLRHLTTGHYLALTEDKGL
VLQDRENSDTVSTAFCFRASKEKLESSPKKDVEGMGVPEIKYGDSLCFIMHMTTGLWLSY
QAPDVKSTRLGPLKRRACLHAEGHMDDGFTLQRCQNEESRAARIIRNTTRLFSHFIRDLD
SLAGKNRTAVVLPIYEVLQTLNDLITYFQLPDAELEHEEKQIKLRSLKNRQNLFKQEGML
ILVSNCIDRLSVYNSAAHFGECVGEEAGTAWKDILNLLYELLAALIRGNRNNCTQFSQNL
DWLVSKLERLESSSGILEVLHCILIESPEALNIIQRGHIKSIISLLYKHGRNHKILDVLC
SLCVCNGVAVRANQNLICDQLLPKRDLLLQTRLVNDVQSMRPNIFLGVREGSAQYKKWYF
ELMIDQVEHFITSEPSHLRVGWASSKGYAPYPGGGEGWGGNGVGDDLYSYGFDGLHLWSG
RIPRRVASVNQHVLASDDVVSCCLDLGAPSISFRINGQPVQGMFESFNTDGLFFPVVSFS
AGVKVRFLLGGRHGEFKFLPPSGYAPCYEALLPKEKMRVEPVKEYKRDVDGVRDLLGTTQ
FLSQASFIPTPVDTSQIVMPPHLEKVRDRLAENIHELWAINKIELGWSYGKIRDDNKRQH
PCLVDFSKLPETERNYNLQMSTETLKTLLALGCHVVQVSVNAEEELKKVKLPKNYMMSNG
YKPMPLELSEVKLSPAQELLVDKLAENAHNVWAKDRVKQGWTYGIQQDLKSKRNPRLVPY
ALLDERTKKSNRDSLRETVRTLIGYGYNIEPPDQEGGQVMERLSIDKIRFFRLERTYAVK
TGKWYFEFEVVTGGDMRVGWARPGVRPDVELGTDDQAYVFDGYKGHRLHQGSRLFGRCWH
AGDVVGCMINMEDKSMIFTLNGEILITNKGSELCFADFETEDGFIPVCSLGLSQVGRMNL
GKDASTFKYYTMCGLQEGFEPFAVNMNREVTMWFSKRLPTFFNVPKDHSHIAVTRIDGTI
DSPPCLKVTHKTFGTQNSNADMVFCRLSMPVEFHSTYKSVPATEVNGVHEEEPLKLKYRY
PVKSMKHIDEGRRIDYSSITTYYHSVRVFAGQDPSCVWVGWVTPDYHYYSNYFNLSKTRT
VTVTLGDERGRVHESVRRSNCYMVWGGDAISSGHSSSRSNVDLEIGCHIDLATGLVAFTV
NGRELPASYQVESNTKLFPAVFVRPTSPNLFQFELTKIKNAMPLSSAIFKSEHKNPIPQC
PPRLDIQTIKSVLWSRMPNTFLKVDTARVSERHGWQVQCLDPLQMLAVHIPEENWCVDIM
ELSEQEDLQTFHYHTLKLYRALCALGNTRVAHALCSHLDQSQLLYIIDNQYLSGMLRQGF
YDVLISIHLETAKAAQLMMNNEFIIPITAETRSIRLFPDSSKQHQPPGVGLSTSLKPRLS
FAPPCFITPKRDQYLYSPEIPLDVLREKAISMLTEAVQGGGDHIRDPVGGSVEYQFVPIL
RMISTLLTMGVLNSQDVHKILLLIEPHVFGEQKSDEMGKATEKEGMTGAEEKAVEAGEEE
AKDTKQPIKGLLEKKLPESVKLQMCKLLQYFCDCELRHRIEAIVSFSDSFVSKLQYNQKF
RYNELMLALNMSAAVTAKKTKEFRSPPQEQINMLLNFSMGDDCPCPVDIQEELYDFHSEL
RLHCGIPMEEEEEDQDTSIKGRLMALVNKIKGQPHKAEMKPTEKEQAIPSNLKELISQTM
VSWAQESHIQDPELVRAMFSLLRRQYDSIGELLRAMRKSYTISAASVHDTIHLLASLGQI
RSLLSVRMGKEEEQLMIHGLSDIMNNKVFYQHPNLMRVLGMHETVMEVMVNVLGGGKSQE
IAFPKMVASCCRFLCYFCRISRQNQKAMFDHLSYLLENSSVGLASPSMRGSTPLDVAASS
VMDNNSLALALEEPDLEKVVTYLAGCGLQSCPMLLAKGYPDIGWNPIEGERYLSFLRFAV
FVNGESVEENSSVVVKLLIRRPECFGPALRGEGGNGLLAAMKEALKISETPALDLSSTTQ
GLISDASTEDEEEEEVVHMGNAIMSFYSALIDLLGRCAPEMHLINKGKGEALRIRAILRS
LVPTEDLVGIISIPLRMPVVNKDGSVTEPDMSACFCPDHKAPMVLFLDRVYGIEDQSFLL
HLLEVGFLPDLRAAASLDTEALRTTETALTMNRYIGSAMLPLLTRCAPHFAGTEHHATLI
DSTLHTIYQLSKGSSLTKAQRDAIEECLLAVCKYLRPSMLQQLLRRLVFDVPLLSEYCKM
PLKLLTNHYDQNWKYYCLPSGWGSYGMASEEELLLTKKIFWGIFDSLSQKKYEQELFKMA
MPCLSAIAGALPPDYVDSSLSTTLEKPVFLDVQGNFDPRPISTTNISLPEKLEYITHKYA
EHSHDKWSTEKVVLGWKYGDSIDEKAKTHPMLRSYKSLTEKEKEVYRFPVKESLKSMLAM
GWNIDRTKEGEAMFQQRENEKMRKISQASQGSGFHPSPVDMSNVLLSRELQAMVEVLAEN
YHNIWAKKKKSDLAVKGGTHPLLVPYDTLTAKEKARDREKAQDLFRFLQINGYSITRGLK
DMEQDSSSMEKRFAYKFLKKLLKYVDCAQEYIAHLEAMASSGKNDRSPHEQEIKFFAKVL
LPLIDQYFKNHSLYFLSSPSKNLSSSGYASNKEKEMVTSLFCKLAALVRHRISLFGSDST
TMVSCLHILAHTLDTRTVMKSGSELVKAALRTFFENAADDLEKTLENLKLGKFTHSRSQM
KGVSQNINYTTVALLPILTALFEHITEHQFGVDLLLDDVQVSCYRILSSLYSLGTGKNIY
VERQLPALGECLATLAGAMPVAFLEPHLNTHNPFSVFNTKAARERAILGMPDTVEQMCPE
VPHLDCLMKDINDMSESGARYTEMPHVIEVVLPMLCNYLSYWWERGTENQAKGTETACST
TVTSEHLSVILGNILKILNSNLGIDEASWMKRIAVYAQPIISKARADLLKAHFLPTLEKL
KKKTVKVVAEEELLKADNKGDTQEAELLILDEFAVLCRDLYAFYPMLIRYVDNNRSRWLK
EPDSDSNELFRMVAEIFILWCKSHNFKREEQNFVVQNEINNLSFLTGDSKTKMSKVGGQD
QERKHKKRRGEIYSIQTSLIVAALKKMLPIGLNMCTPGDQELISLAKTRYGLKDTDEEVK
EHLRRNLHLQEKSEDPAVRWQLHLYKDVIVKNEGPPDPERTIDRLQTISAAVFHLEQVEQ
PLRSKKCVWQKLLSKQRKRAVVACFRMAPLYNLPRHRSINLFLTGYQRIWIETETYSFEE
KLVQDLARTQRKLEEEEEELDEIQHDPLHQLILHFSHNALTEKSSLEDDLLYIAYTDMMA
KSCAEDENEDEEGKEKTFEEKEMEKQKILYQQARLHDRGAAEMVLQMISASRGRLGPMVT
FTLKLGISILNGGNILVQQKMLDYLKEKRDAGFFKSLSGLMQSCSVLDLNAFERQNKAEG
LGMVTEEGSINVRERGSKVLQNDEFTKDLFRFLQLLCEGHNNDFQNFLRTQTGNTTTVNI
IISTVDYLLRLQESISDFYWYYSGKDIMDEAGQRNFSKALAVAKQIFNSLTEYIQGPCIG
NQQSLAHSRLWDAVVGFLHVFANMQMKLSQDSSQIKLLKELMDLQKDMIVMMLSLLEGNV
VNGTIGKQMVDTLVESSNNVEMILKFFDMFLKLKDLTTSDNFKEHDSDAKGVISKREFQK
SMENQKQYSQSEIEFLLSCVEADENDMFNYVEFVKRFHEPAKDIGFNVAVLLTNLSEHMP
HDSRLATFLSLAESVLNYFEPFLGRIEIMGGAKRIERVYFEISESSRTQWEKPQVKESKR
QFIFDVVNEGGESEKMELFVNFCEDTIFEMQLASLISEPDAVERGEEDEIELQKVSKDLE
MEEEENTLESSSAFTMACVSMKKNLCSLGRLLTLKSLRKRYKKLRKMSLREMISGFFFFF
WIIFTGLLHFLYNLVWCFFHILWSSLFGGGLVEGAKNMKVTDILGNMPDPTQFGIHGDVL
ESEKLEVSEASLVAEINQMAQGDKTEIDLMSELLSIQPKKEGGKHGTEPGLGDVSEVVGV
DSPSLVSAVQQKKAQEAASKSVENESNAESEKADTEDGEKNDQDKAKELLIEPPSQEEKK
LPKRRCGQKKEQPEAIMASFFAGLDIYQTKILNYLARNFYNLRFLALFVAFAINFILLFY
KVTGEESEEVDSWTGRHEEEDEGGIEYFILQENTGYMAPTLRFLAVLHTIISFLCVVGYY
YLKVPLVVFKREKEIARKLEFDGLYITEQPSDDDIKGQWDRLVINTPSFPNNYWDKFVKR
KVINKYGDLYGAERIAELLGLDKSALDFNPTEETIAKEASLVSWLSSIDTKYHIWKMGVV
ITDNSFLYLVWYTTMSILGHYNNFFFAAHLLDIAMGFKTLRTILSSVTHNGKQLVLTVGL
LAVVVYLYTVVAFNFFRKFYNKSENEDEPDMKCDDMMTCYLFHMYVGVRAGGGIGDEIED
PAGDPYELYRILFDITFFFFVIVILLAIIQGLIIDAFGELRDQQEQVKEDMETKCFICGI
GNDYFDTTPHGFETHTLQEHNLANYLFFLMYLVNKDETEHTGQESYVWKMYQERCWDFFP
AGDCFRKQYEDQLG
Download sequence
Identical sequences A0A2D0RQF4
XP_017332742.1.5077

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]