SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017353319.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017353319.1.71028
Domain Number 1 Region: 427-484
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.29e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 25-82
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-23
Family KRAB domain (Kruppel-associated box) 0.00068
Further Details:      
 
Domain Number 3 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.61e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 4 Region: 596-652
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.56e-22
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 539-596
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-22
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 374-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-19
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 7 Region: 315-370
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-19
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 8 Region: 637-689
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.22e-19
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 9 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.09e-18
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 10 Region: 484-540
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-16
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 
Domain Number 11 Region: 165-217
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000435
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 12 Region: 120-164
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000187
Family Classic zinc finger, C2H2 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017353319.1.71028
Sequence length 698
Comment PREDICTED: zinc finger protein 433 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MFQDSAAFEDVTVLVLPILLCTCGMFQDSVAFEDVAVTFTQEEWALLDPSQKTLYRDVMQ
ETFRNLASVGKKWKAQNIYVEYKNLRRNLRNLMGKRLFESKKDHQHGEILTQVPDDMLRK
KTTTGVKSCKSSVCGKVGSGHSSLKRHIRDDTGHKAYEYQEYGQKPYKCKHCKKAFNCLS
SVQTHERAHSGRKPYVCEECGKAFISHSTFQRHRIMHSGDGPYKCKFCGKALMFLSLYLI
HKRTHTGEKPYECKQCGKTFSHSGSLRIHERTHTGEKPYKCTECGKAFHSSTCLHAHKRT
HTGEKPYECKQCGKAFSSSHSFQIHERSHTGEKPYECKECGKAFKCPSSVSRHERTHSRK
KPYECKHCGKVLSYLTSFQNHLGMHTGEIPYKCKICGKAFYFPSSLQTHEKTHIGEKPYK
CKQCGKAFNSSSSFRYHERTHTGEKPYECKQCGKAFRSASLLQTHGRTHTGEKPYACKEC
GKGFSNFSFFKVHERMHREEKPYECKDYEKAFSLPSFFHRHERAHTGKKTYDCKQCGRSF
NCSSSFRYHGRTHTGEKPYECKQCGKAFRSASHLQMHGRTHTGEKPYGCKQCGKAFGSAS
QLRMHERTHSGEKPYECKQCGKAFGCASRLQMHGRTHTGEKPYKCKQCGKAFGCPSNLRR
HGRTHTGEKSYKCKQCGKIFRCSSQLQVHERTHCTGTP
Download sequence
Identical sequences XP_017353319.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]