SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017354322.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017354322.1.71028
Domain Number 1 Region: 32-116
Classification Level Classification E-value
Superfamily F-box domain 1.46e-16
Family F-box domain 0.0046
Further Details:      
 
Domain Number 2 Region: 98-259,332-391
Classification Level Classification E-value
Superfamily RNI-like 0.0000000000769
Family 28-residue LRR 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017354322.1.71028
Sequence length 428
Comment PREDICTED: F-box/LRR-repeat protein 3 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MKRGGRDSDRNSSEEGTAEKSKKLRTTNEHSQTCDWGNLLQDIILQVFKYLPLLDRAHAS
QVCRNWNQVFHMPDLWRCFEFELNQPATSYLKATHPELIKQIIKRHSNHLQYVSFKVDSS
KESAEAACDILSQLVNCSLKTLGLISTARPSFMDLPKSHFISALTVVFVNSKSLSSLKID
DTPVDDPSLKVLVANNSDTLKLLKMSSCPHVSPAGILCVADQCHGLRELALNYHLLSDEL
LLALSSEKHVRLEHLRIDVVSENPGQTHFHTIQKSSWDAFIRHSPKVNLVMYFFLYEEEF
DPFFRYEIPATHLYFGRSVSKDVLGRVGMTCPRLVELVVCANGLRPLDEELIRIAERCKN
LSAIGLGECEVSCSAFVEFVKMCGGRLSQLSIMEEVLIPDQKYSLEQIHWEVSKHLGRVW
FPDMMPTW
Download sequence
Identical sequences A0A2K5S914 G3QVS1 H2NK32 H2R286 Q9UKT7
9598.ENSPTRP00000043543 9600.ENSPPYP00000006181 9606.ENSP00000347834 ENSP00000347834 ENSPPYP00000006181 ENSPTRP00000043543 ENSP00000347834 gi|16306584|ref|NP_036290.1| HR2963 4i6j_B ENSP00000347834 ENSPTRP00000043543 NP_036290.1.87134 NP_036290.1.92137 XP_003825292.1.60992 XP_005266393.1.92137 XP_009246982.1.23681 XP_009246983.1.23681 XP_016780467.1.37143 XP_017354321.1.71028 XP_017354322.1.71028 XP_018895155.1.27298 ENSPPYP00000006181

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]