SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017358243.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017358243.1.71028
Domain Number 1 Region: 50-160
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 4.19e-38
Family Frizzled cysteine-rich domain 0.0000587
Further Details:      
 
Domain Number 2 Region: 177-305
Classification Level Classification E-value
Superfamily TIMP-like 1.1e-23
Family Tissue inhibitor of metalloproteinases, TIMP 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017358243.1.71028
Sequence length 315
Comment PREDICTED: secreted frizzled-related protein 5 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MRAAAGGARTAALALLLGALRWAPARGEEYDYYGWQAEPLHGRSYSKPPQCLDIPADLPL
CHTVGYKRMRLPNLLEHESLAEVKQQASSWLPLLAKRCHSDTQVFLCSLFAPVCLDRPIY
PCRSLCEAVRAGCAPLMEAYGFPWPEMLHCHKFPLDNDLCIAVQFGHLPATAPPVTKICA
QCEMEHSADGLMEQMCSSDFVVKMRIKEIKIENGDRKLIGAQKKKKLLKPGPLKRKDTKR
LVLHMKNGAGCPCPQLDGLSGSFLVMGRKVDGQLLLMAVYRWDKKNKEMKFAVKFMFSYP
CSLYYPFFYGAAEPH
Download sequence
Identical sequences A0A2K5RUS5 F6ZL04
ENSCJAP00000051114 XP_002756546.1.60252 XP_017358243.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]