SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017360575.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017360575.1.71028
Domain Number 1 Region: 49-545
Classification Level Classification E-value
Superfamily Sema domain 4.71e-99
Family Sema domain 0.001
Further Details:      
 
Domain Number 2 Region: 1408-1534,1700-1856
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.37e-33
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 886-978
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000385
Family Other IPT/TIG domains 0.02
Further Details:      
 
Domain Number 4 Region: 977-1067
Classification Level Classification E-value
Superfamily E set domains 0.00000000000021
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.043
Further Details:      
 
Domain Number 5 Region: 1065-1145
Classification Level Classification E-value
Superfamily E set domains 0.00000000000187
Family E-set domains of sugar-utilizing enzymes 0.069
Further Details:      
 
Domain Number 6 Region: 548-599
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000016
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017360575.1.71028
Sequence length 1924
Comment PREDICTED: plexin-D1 isoform X1 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MAPRAAGGAPLSARAAAASPQPFPTPPQCSVPLLLLLLGAARAGALEIQRRFPSPTPTNN
FALDGAAGTVYLAAVNRLYQLSGANLSLEAEAALGPVSDSPLCYAPQLPHASCPHPRRLT
DNYNKILQLDPGQDLVIVCGSIYQGFCQLRRRGNISAVAVRFPPAPPSAEPITVFPSMLN
VAANHPNASTVGLVLPPAVGAGTSRLLVGATYTGYGSAFFPHNGSLEDHRFENTPEIAIR
SLDVGGDLAKLFSFNLNPSDDNILKIKQGAKEQHKLGFISAFVHPPDPPPGAQSYAYLAL
NSEARSGIKETQARSLLARICLPGGASGDFKKLTESYVQVGLQCAGGAGRGDLYSRLVSV
FPSGERLFAVFERPQGSSAVRAAPAALCAFRFEDVRTAVRDARNACFVEPKPDVVEVLNN
VVQGSGPDCERKLNIQLHPEHLDCGAPHLQHPLSILQPLEATPIFRALGLTSVAVASIDN
YTAVFLGTVNGRLLKISLNENMQVVSRRVVTVAYGEPVHHVMQFDPADSGYLYLMTSHQI
AKVKVAACDVHSTCGDCVGAADAYCGWCALESRCTLQQDCANSSQQHFWTSASEGPGRCP
AMTVLPAEIDMHQEYPGMILQVSGSLPSLSTMEMACDYGNDIRTVARVPGPAFGHQIAYC
NLLPRDRFPPFPPNQDHMTIEMSVRVNGRNIVRANFTIYDCSRIAQVYPHTACTSCLSAQ
WPCFWCTQQHSCVSNQTRCEASPNPTSPQDCPRTLPSPLAPVPTGGSQNILVPLANAAFF
QGAALECSFGLEEVFEAVWVNQSIVRCDQVVLHTTQKSQVFPLSLQLKGQPARFLDSPEP
MTAVVYNCATGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQPLPGTCPAPEIREIEPLSG
PLDGGTLLTIRGRNLGRRLSDVAHGVWIGGVACEPLPDRYTVSEEIVCVTGPAAGLLSDV
VTVNASKEGKSRDRFSYVLPLVHSLEPAMGPKAGGTRITIHGSDLHVGSELQVLMNDTDP
CRELMRTDTSVACTVPEAALAAPVPVCVRFEHRDCVHGNLTFWYTENPVITAISPHRSPV
SGGRTITVAGEHFHMVQNVSMTVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVDFFI
NGRAYADELAVAEELLDPEEAQQGSRFHLDYLPNPQFSTAKREKWIKHHPGEPLTLVIHK
EQDSLGLQSHEYQVKIGQVSCDIQIVSDRVIHCSVNESLGEAEGQLPITIQVGNFNQTIA
TLQLGGSETAIVVSIVICSILLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREE
IRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQTLNSQ
GISQVQETHPLLGEWKIPESCRPNMEEGIGLFSSLLNNKHFLIVFVHALEQQKDFAVRDR
CSLASLLTIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSIC
MYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVS
FQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSYILR
DLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLIDKKDNTLGRVKDLDTEKYFHLVPPTD
ELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFF
DFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVIAQA
FIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIQDMTPLSEQEMNAHLAEES
RKYQNEFNTNVAMAEIYKYAKRYRPQIMAALEANPTARRTQLQYKFEQVVALMEDNIYEC
YSEA
Download sequence
Identical sequences A0A2K5QNR0
XP_017360575.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]