SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017369421.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017369421.1.71028
Domain Number 1 Region: 37-96
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.12e-26
Family KRAB domain (Kruppel-associated box) 0.00068
Further Details:      
 
Domain Number 2 Region: 597-654
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.21e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 485-542
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.84e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 4 Region: 653-710
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.4e-23
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 5 Region: 429-486
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.56e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 6 Region: 542-598
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.3e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 373-430
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.25e-19
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 321-374
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000105
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 9 Region: 280-331
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000006
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 10 Region: 699-751
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000084
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 11 Region: 215-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000724
Family Classic zinc finger, C2H2 0.036
Further Details:      
 
Domain Number 12 Region: 127-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000944
Family Classic zinc finger, C2H2 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017369421.1.71028
Sequence length 756
Comment PREDICTED: zinc finger protein 778 isoform X2 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MAAPDLAHRGRVSKDLVCLHGEQTQAAGMLAGWLIDSYQDSVTFDDVAVDFTQEEWTLLD
PSQRDLYRDVMLENYENLASVGRHLFKPSVICWLEEEGQLRAGQRGVLQEWQLESKGSAL
QQDRAWFRASDETQMARSHSGGQLCDRMQCGEAVSEPSDLSTHVRTQNTGYSCVCNHYGK
DFLISHQKTLCKAGGQFSVLDQCGKAFSTAPNVVYQQTCTWDKSFDYSNCGKAFLNQTYL
QGRMRTHNREGTCKWKQCGKALTHSPGHAATVEMHAVRNPHVYRECGKAFGCTAYLTSHM
RIHTGEKPCEFKECGKSSPVSSSLTQHVSIHAAEKPCECKECGRTVTGCSGLSQHVQAHA
REKPYECKDCGKAYSRFYLLSEHLKTHMREKPFACVVCGKYFRNSSCLNNHLRIHTGIKP
YTCSYCGKAFTVRCGLTRHVRTHTGEKPYMCKDCGKAFCTSSGLTEHVRTHTGEKPYECK
DCGKSFTVSSSLTEHVRIHTGEKPYECKQCGKAFTGRSGLTKHERTHTGEKPYECKDCGK
AYNRVYLLNEHVKTHTEEKPFICKICGKSFRNSSCLNKHVQIHTGIKPYECRDCGKTFTV
SSSLTEHVRTHTGEKPYECKTCGKAFTTSSHLIVHVRTHTGEKPYMCKECGKAFASSSHL
IEHRRTHTGEKPYICNECGKAFRASSHLRKHGRIHTGQKPYKCKDCGKAYNRFYLLKEHL
KTYTEAQLFVCKDCGESFKNSSCLNHHTQIHTEKPC
Download sequence
Identical sequences XP_017369421.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]