SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017381481.1.71028 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017381481.1.71028
Domain Number 1 Region: 280-376
Classification Level Classification E-value
Superfamily Immunoglobulin 7.83e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 439-730
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.00000000000000196
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.042
Further Details:      
 
Domain Number 3 Region: 25-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000166
Family Ovomucoid domain III-like 0.0094
Further Details:      
 
Domain Number 4 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000717
Family I set domains 0.055
Further Details:      
 
Domain Number 5 Region: 124-191
Classification Level Classification E-value
Superfamily EF-hand 0.00000000107
Family Calmodulin-like 0.045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017381481.1.71028
Sequence length 792
Comment PREDICTED: follistatin-related protein 5 isoform X5 [Cebus capucinus imitator]; AA=GCF_001604975.1; RF=representative genome; TAX=1737458; STAX=9516; NAME=Cebus capucinus imitator; AL=Scaffold; RT=Major
Sequence
MIQDGPFGSCENKYCGLGRHCVISRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVH
RAACLKKQKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYIMQENENPNGDDISR
KKLLVDQMFKYFDADSNGLVDINELIQVIKQEELGKDLFDCTLYDLLKYDDFNADKHLAL
EEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNTLDLE
DINDFGDDGSLYITKVTTTHMGNYTCYADGYEQVRQTHIFQVNVPPVIRVYPESQAREPG
VTASLRCHAEGIPNPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIA
KNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRH
IKPSEKLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVTQPTLDRVLIVDVQSQKVV
QAVSTDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQF
DRVDDFFIPTTTLIITHMRFGFILHKDEAALQKIDLETMSYIKTINLKDYKCVPQSLAYT
HLGGYYFVGCKPDSTGAVPPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGL
VRVQYITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGK
VKMIKSLKEPLKAEEWPWNRINRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEV
EKGNTVIWVGDA
Download sequence
Identical sequences XP_017381481.1.71028

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]