SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017443159.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017443159.1.4139
Domain Number 1 Region: 194-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.87e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 2 Region: 390-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.12e-24
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 3 Region: 446-503
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-24
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 334-391
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.98e-24
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 5 Region: 250-307
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.26e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 502-559
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.24e-22
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 7 Region: 28-83
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.36e-21
Family KRAB domain (Kruppel-associated box) 0.0002
Further Details:      
 
Domain Number 8 Region: 558-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.63e-20
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 9 Region: 614-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.28e-19
Family Classic zinc finger, C2H2 0.0092
Further Details:      
 
Domain Number 10 Region: 155-197
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000427
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 11 Region: 297-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000468
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 114-167
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000356
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017443159.1.4139
Sequence length 677
Comment PREDICTED: zinc finger protein 431-like isoform X1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MIGLMCFDVGCLVSYGRAANLLSRDMKTVTYEDVHVNFTQEEWTLLDPFQKKLYKDVMLE
TYRNLNAIGFNWEDQNIEEHCQSSRRQGRHERSQSAEIPSEYTHCGKPFALHAHSHPQRN
EEIHSEKNPSEVIQCVEAFAPYTVLQIHKRTQARQKPYEYSQCAKVFGNHSKLKKHERLH
TEKKPYKCHECDKAFSQPFRLQKHQRVHTGEKPYKCNECDKAFSRPSSLQTHKRVHTGEK
PYKCNECDKAFSVHSSLQRHKSVHTGEKTYKCNECDKAFSRHSSLQRHKRVHTGEKPYKC
NECDKAFSEHHSLQQHKPVHTGEKPYKCNECDKAFSRHSSLQKHKRVHTGEKPYKCNECD
KAFSVHSSLQKHKSVHTGEKPYKCNECDKAFSRHSSLQKHKRVHTGEKPYKCNECDKAFS
EHSSLQIHKRVHTGEKPYKCNECDKAFSVHSSLQTHKRVHTGEKPYKCNECDKAFSDHNS
LRTHKRIHTGEKPYKCNECDKTFLYHTSLRIHKRVHTGEKPYKCHECDKAFSAPSILYRH
KRVHTGEKPYKYNECDKVFSDHGNIQRHKRIHTEDKLYKCSDCGEAFSQHNRLLIHERIH
TGGKPYKCKECDKAFSRPSRLQIPNRVHTGDKPYICNECDNAFSQPSRLQVHRRIHTGAK
PVKCSECVKPFSQQNSL
Download sequence
Identical sequences XP_017443159.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]