SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017445435.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017445435.1.100692
Domain Number 1 Region: 426-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.88e-25
Family Classic zinc finger, C2H2 0.0067
Further Details:      
 
Domain Number 2 Region: 174-231
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.2e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 3 Region: 370-427
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-23
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 4 Region: 483-539
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.76e-23
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 286-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.29e-23
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 538-595
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-21
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Domain Number 7 Region: 231-287
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.91e-21
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 8 Region: 8-64
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.03e-20
Family KRAB domain (Kruppel-associated box) 0.00016
Further Details:      
 
Domain Number 9 Region: 118-175
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.92e-20
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 10 Region: 601-657
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.8e-19
Family Classic zinc finger, C2H2 0.0093
Further Details:      
 
Domain Number 11 Region: 70-119
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000021
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 12 Region: 334-365
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000191
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017445435.1.100692
Sequence length 663
Comment PREDICTED: zinc finger protein 431-like isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MRMEFNAKDALTYDDVHVNFTREEWALLDPSQKSLYKDVMQETYRNLTAIGYNWEDHTIE
EHCQSFRRHGRHERCHTGEKPSENTQCGKAFAQHSHLQRHKSTHTGEKLYECKPCDKAFT
YDSQLQTLERIHTGEKPYKCNQCGKAFERRCNLGKHKLIHTGRKSYKCNQCGKAFARHSH
LKTHGITHTGEKPYECDQCGKAFAYHSYLQVHKRIHTGEKPYECNQCGKAFVGQNDLKRH
ERIHTGEKPYKCNECDKGFGHHQNFRMHKMMHAGEKPYKCNQCGKAFSQNSHLQTHKSTH
TGEKPYKCDQCGKAFTSHSYLQVHKRIHTGEKLCECEQCGKAFTSHSYLQVHKRIHTGEN
LYECNQCGKTFASHSYLQVHKRIHTGEKLYECNQCGKAFASHSYLQVHKRIHTGEKLYEC
DQCGKAFASHSHLQVHKRIHTGEKPYVCDQCGKDFVVQSDLKRHKRTHTGEKPYKCNECG
KAFVGQNDLKKHKRKHTGEKPYKCNECGKAFVWNGSLRTHKVIHSGEKPYKCNECGKAFA
CNSSLRTHKAIHTGVKPFKCKHCGKAFVGQNYLKKHERIHTGEKLYKCNECGKAFQCGKA
FVGQNDLKRHERIHTGEKPYECNECGKAFVCNASLRKHKATHTRVKPYDCKQFSKFFASH
DQL
Download sequence
Identical sequences XP_017445435.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]