SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017447861.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017447861.1.100692
Domain Number 1 Region: 573-630
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.99e-25
Family Classic zinc finger, C2H2 0.007
Further Details:      
 
Domain Number 2 Region: 238-294
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.33e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 3 Region: 294-350
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.46e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 4 Region: 350-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.3e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 517-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 182-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.07e-23
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 7 Region: 2-63
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.35e-21
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 8 Region: 462-518
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 9 Region: 619-671
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-20
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 10 Region: 395-447
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.86e-20
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 11 Region: 143-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000335
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 12 Region: 102-154
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000215
Family Classic zinc finger, C2H2 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017447861.1.100692
Sequence length 680
Comment PREDICTED: zinc finger protein 25 isoform X2 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MTKFKGPVTLRDVTVEFTKAEWKLLTPAQKSLYKNVMLETYSHLVSVGYRVVKPSMISKL
KKGKEPWPLGAEFLRRSCGDKRRTVHDPKARHQEQQAGTARKGELAKRQKTPTRHESYDC
SKCGKSFCQKSSLLAHQETHTKKSYKCDKCGQAFYKNEDLSIHQKVHTRDKTYPCKECNK
IFYHLSSLTRHLRIHAGEKPYECSQCEKSFYQKPHLTEHQKTHTGEKPFECKECGKFFYV
KAYLLVHQKTHTGEKPFECKECGKFFSQKSHLTVHQRTHTGEKPYKCKECGKLFSRNSHL
ITHQRTHTGEKPYKCKECGNRFYQKSALTVHQRTHTGEKPFECSKCGKHFYYKSDLTKHE
RKHTGEKPYECAECGKSFSVNSVLRLHERTHTGEKPYACEICGKSFSQKSHFVVHQRKHT
GEKPYKCQECGKSFIKKSQLTEHQKTHSGGKPYEYHENRKNFSKKSHPTQSRRAHVGEKT
FECGECGKMFWEKSNLTQHQRTHTGEKPYACTECGKAFCQKPHLTNHQRTHTGEKPYECK
QCGKTFCVKSNLTEHQRTHTGEKPYECNACRKSFCHRSALTVHQRTHTGEKPFICNECGK
SFCVKSNLIVHQRTHTGEKPYKCNECEKTFCEKSALTKHQRTHTGEKPYECNVCGKTFSQ
RSVLTKHQRIHTRVKALLAS
Download sequence
Identical sequences XP_017447861.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]