SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017450175.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017450175.1.100692
Domain Number 1 Region: 23-134
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 1.31e-37
Family Frizzled cysteine-rich domain 0.0000764
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017450175.1.100692
Sequence length 710
Comment PREDICTED: frizzled-6 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MEASPFLSACILLPLIRGHSLFTCEPITVPRCMKMAYNMTFFPNLMGHYDQGIAAVEMEH
FLPLANLECSPNIEMFLCQAFVPTCTEQIDVVSPCRKLCEKILSDCQKLMDTFGIRWPEE
LECHRLPYCDGAVPVTSDPHTELFGPQKKTDQVPRDIGFWCPKHLRTSGDQGYRFLGIDQ
CAPPCPNMYFKSDELDFAKSFIGIVSIFCLCATLFTFLTFLIDVRRFRYPERPIIYYSVC
YSIVSLMYFVGFLLGNSTACNKADEKLELGNTVVLGSKNKACSVVFMFLYFFTMAGTVWW
VILTITWFLAAGRKWSCEAIEQKAVWFHAVAWGMPGFLTVMLLAMNKVEGDNISGVCFVG
LYDLDASRYFVLLPLCLCVFVGLSLLLAGIISLNHVRQVIQHDGRNQEKLKKFMIRIGVF
SGLYLVPLVTLLGCYVYELVNRVTWEMTWFSDHCHQYRIPCPYQANPKARPELALFMIKY
LMTLIVGISAVFWVGSKKTCTEWAGFCKRNRKRDPISESRRVLQESCEFFLKHNSKVRHK
KKHGKPGSHKLKVISKSMGTSTGVTTDHGTSAVAIADHDYLGQETSAEVQTSPEASLKEG
RADRANTPRAKGPDCGEPASTAASNSKFSGDQIDRKSRAGSVKEKSSVSEGAPSEGRVSP
KGVPGTGLMECTLQIPSSPEPNSLKGSTSLLVRSASGTRKEQGAGGHSDT
Download sequence
Identical sequences G3V6L1
10116.ENSRNOP00000006195 ENSRNOP00000006195 ENSRNOP00000006195 NP_001124008.1.100692 NP_001124008.1.4139 XP_017450173.1.100692 XP_017450174.1.100692 XP_017450175.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]