SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017450699.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017450699.1.4139
Domain Number 1 Region: 436-493
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.17e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 2 Region: 240-297
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.98e-25
Family Classic zinc finger, C2H2 0.0037
Further Details:      
 
Domain Number 3 Region: 184-241
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.8e-25
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 4 Region: 296-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.93e-25
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 5 Region: 548-605
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.71e-24
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 6 Region: 492-549
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.67e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 7 Region: 590-642
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.57e-21
Family Classic zinc finger, C2H2 0.004
Further Details:      
 
Domain Number 8 Region: 129-185
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.05e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 9 Region: 12-72
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.96e-20
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 10 Region: 352-409
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.56e-20
Family Classic zinc finger, C2H2 0.0058
Further Details:      
 
Domain Number 11 Region: 91-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.14e-16
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 12 Region: 400-431
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000128
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017450699.1.4139
Sequence length 661
Comment PREDICTED: zinc finger protein 420-like isoform X4 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MIIQVFIIAKELTQDLLSFTDVAIDFSPEECECLEPAQWNLYKEVMLENYSNLLFLGLAF
SKPYLVTCLEQRKEPWNVKEPATVAVYPGSKPYIFKECGKTFPWNSLLIQHHKIHPGAKL
YTCDECGKSFNVRSTLYKHHRTHTGEKPYKCKECGKAFTCSSSLNQHHRIHTGEKPYKCE
CGKAFNNSSALTQHQRIHTGERPYKCDECGKAFNNCSARTRHQRIHTGERPYKCAQCGKT
FNFPTSLSQHQRIHTGEKPYKCEECGKAFNNCSALTQHQRIHSGEKPYKCEECGKAFYNC
SALSRHQKIHTGEKPYKCADCGKAFIFRSSLSQHQRIHTGEKPYKCKECGKAFNCSSHLN
QHGRIHSGEKPYKCEECGQTFICSSYLHKHQKIHAIEKLYECKDCGKAFSCSSYLKYHQR
FHTGGKSYTCKECDKTFRSSSYLRNHQRFHTGEKPYTCKECGKAFVNSSSLLVHQRIHTG
EKPYKCKECGKAFRCSSYFKYHQRLHTGEKPYTCKECGKAFAKSSCLILHQRIHTGEKPY
KCAECGQAFICSSYLRKHQRIHTGEKPYTCEECGKAFSIYSTFAQHQRIHTGEKPYKCKE
CNKAFNNHSALIKHQRIHTGEKPYACKECSKAFNNSSSLIRHQRIHIGIETLEIQGIWQG
L
Download sequence
Identical sequences XP_017450699.1.4139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]