SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017453258.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017453258.1.100692
Domain Number 1 Region: 402-459
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.89e-25
Family Classic zinc finger, C2H2 0.0077
Further Details:      
 
Domain Number 2 Region: 290-347
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.37e-24
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 3 Region: 446-507
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-22
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 4 Region: 235-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.63e-22
Family Classic zinc finger, C2H2 0.0088
Further Details:      
 
Domain Number 5 Region: 543-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.24e-22
Family Classic zinc finger, C2H2 0.0079
Further Details:      
 
Domain Number 6 Region: 346-403
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.62e-22
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 7 Region: 178-235
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.58e-22
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 8 Region: 584-636
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.01e-21
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 9 Region: 10-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-21
Family KRAB domain (Kruppel-associated box) 0.00018
Further Details:      
 
Domain Number 10 Region: 500-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-19
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 74-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.61e-19
Family Classic zinc finger, C2H2 0.0074
Further Details:      
 
Domain Number 12 Region: 108-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.02e-18
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017453258.1.100692
Sequence length 642
Comment PREDICTED: zinc finger protein 431-like isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MVSVVLMYGIFQDALTYDDVHVNFTREEWALLDPSQKSLYKDVMQETYRNLSAIGYNWED
HTIEEHCQSFRRHGRHERCHTGEKPSENTQCGKAFAQRSHLQRHERIHTGEKPYKCNQCG
KAFERHCNLGRHKLIHTGRKSYKCNQCGKAFSQNSHLQTHNSTHSREELYKCKQCGKSFT
CRNELQSHKRIHTGEKSYECNQCGKAFKSHLYLQVHKRIHTGEKPYVCDQCGKDFVVQRD
LKRHKRTHTGEKPYKCDQCGKAFASHRYLQVHKRIHTREKLYECDQCGKAFAQLGHLQVH
GITHTGEKPYECDQCGKAFASHSYLQVHKRIHTGEKPYVCDWCGKAFASHSYLQVHKRIH
TGENLHECDQCGKAFASHSYLQVHKRIHTGEKLYECDQCGKAFTSHSYLQVHKRIHTGEK
PYVCDQCGKDFVVPSELKRHKRTHTGEKPYKCNECGKAFVGQNDLKKHKRIHTGEKPYKC
NECGKAFVWIGNLRTHKVLHTGEKPYKCNECGKAFACSTSLRTHKAIHTGVKPFECKQCG
KAFVGQNDLKRHERIHTGEKPYQCNECGKAFVFDASLRKHRAIHTGVKPYECKQCGKAFV
GQNDLKRHERIHTGEKPYECNECGKAFSQSSQLQLHKKTHTY
Download sequence
Identical sequences XP_017453258.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]