SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017456161.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017456161.1.100692
Domain Number 1 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.28e-24
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 2 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.3e-24
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 495-552
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.35e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 4 Region: 439-496
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.25e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 5 Region: 383-440
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.66e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 6 Region: 552-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.56e-23
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 7 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-23
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 8 Region: 608-664
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.74e-23
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 9 Region: 159-216
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.82e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 10 Region: 663-720
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.03e-20
Family Classic zinc finger, C2H2 0.0073
Further Details:      
 
Domain Number 11 Region: 19-76
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.23e-20
Family KRAB domain (Kruppel-associated box) 0.00022
Further Details:      
 
Domain Number 12 Region: 107-160
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000196
Family Classic zinc finger, C2H2 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017456161.1.100692
Sequence length 721
Comment PREDICTED: zinc finger protein 431-like isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MPNVVSIVLSFVPMYGILEKTVTYEDVHVNFTQEEWALLDPFQKKLYKDVMLETYKNLNA
IGFNWEEKNIEEHCQSSRRQRRHERSQSAEIPSEYTHCGKPFALHAHSHAQRNERIHSEK
KPSEVIQCVEAFAPYTVLQLHKRTQARQKPYECSQCGKVFSNHSKLKKHESLHTEKKPYK
CNECDKAFSQLSILYRHQRVHTGEKPYKCNECDKAFSRHSRLKRHNRVHTGEKPYKCNEC
GKAFSLPSRLQMHNRVHTGEKPYKCNECDKVFSIHSSLQRHKRVHTGEKPYKCNECDKAF
SVHSRLKRHNRVHTGEKPYKCNECDKAFSVHSRLKRHNRVHTGEKPYKCKECDKAFSEHD
SLQTHKRVHTGEKPYKCNECDKAFSVHSSLQKHKRVHTGEKPYKCKECDKAFSEHDSLQT
HKRVHTGEKPYKCNECDKAFSVHSSLQKHKRVHTGEKPYKCNECDKAFSEHSSLQKHNRV
HTGEKPYNCNECDKAFSDHNSLRTHKRIHTGEKPYKCNECDKAFSVHSSLQKHQRVHTGE
KPYKCNECDKDFSRHSHLQTHKRVHTGEKPFKCNECDKAFSQHDILQKHKRVHTGEKPYK
CNECDKDFSRHDILQKHKRVHTGEKPYKCNECDKAFSVHSRLQKHKRVHTGEKPYKCNEC
DKAFSDHSSLRKHKKIHTGEKPYKWNECDKTFLYHTSLQIHKRVHTGEKHYKCHECDKAF
S
Download sequence
Identical sequences XP_017456161.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]