SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017456705.1.100692 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017456705.1.100692
Domain Number 1 Region: 231-389
Classification Level Classification E-value
Superfamily TPR-like 7.4e-25
Family Tetratricopeptide repeat (TPR) 0.043
Further Details:      
 
Weak hits

Sequence:  XP_017456705.1.100692
Domain Number - Region: 153-190
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 0.0188
Family HD domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017456705.1.100692
Sequence length 471
Comment PREDICTED: tetratricopeptide repeat protein 29 isoform X1 [Rattus norvegicus]; AA=GCF_000001895.5; RF=representative genome; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=mixed; AL=Chromosome; RT=Major
Sequence
MATFPPLSMTRTKLAVLARQKLPCSSKSIPRAQLIKEKDDIDYYLEQNIKGLSKEEVAAH
RNSYKKSICVDMLRDGFHKSFTELFSLMEQWDKLREAAQARSLFWLQRPLEDQPDKLDNF
YHYLTKAEAAERKGYYEEVYNNLYALACYFDNSEDKWVRNHFYERCFKIAQLIKVDGGKK
EAEAEAHMGLLYEEEGELLKAAEHYEAFHELTQGRLWKDATGQFLNLIACESLVRTYRLL
SDRMLQNRDYKQAIKILIKASEIAREGNDRSMEGEASYYLGLAHLASGEYETALSVLDRY
SEISTSLDDELSLGRAYEAMAKVLQSQGEMTEAIKYLEKFVVIARNNFKSLDVIQACTML
GDIYNEKGQYNKASDYFQQAFSTAMEVTKTTLMDETKVHYGIARAHQMMLTMNGYIESAD
MNSLNCLLSWKETRTQVEYDPILGEARKATEDNIYQFPDAQEETRRSPENQ
Download sequence
Identical sequences Q6AYP3
ENSRNOP00000016558 10116.ENSRNOP00000016558 ENSRNOP00000016558 NP_001013912.1.100692 NP_001013912.1.4139 XP_017456705.1.100692

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]