SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017459959.1.4139 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017459959.1.4139
Domain Number 1 Region: 198-300
Classification Level Classification E-value
Superfamily SRCR-like 1.16e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000851
Further Details:      
 
Domain Number 2 Region: 66-172
Classification Level Classification E-value
Superfamily SRCR-like 1.44e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 353-457
Classification Level Classification E-value
Superfamily SRCR-like 4.45e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0000776
Further Details:      
 
Domain Number 4 Region: 482-585
Classification Level Classification E-value
Superfamily SRCR-like 6.54e-41
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017459959.1.4139
Sequence length 586
Comment PREDICTED: scavenger receptor cysteine-rich domain-containing group B protein isoform X1 [Rattus norvegicus]; AA=GCF_000002265.2; RF=na; TAX=10116; STAX=10116; NAME=Rattus norvegicus; strain=BN; Sprague-Dawley; AL=Chromosome; RT=Major
Sequence
MGPPERPSLGWTPKEADMQSGPQPDEWSSGWKPGDGGAAPLPLSPALSFLLLFPLASALQ
PTPLPFPELRLVGGPSRCRGRLEVMHSGSWGSVCDDDWDVVDANVVCRQLGCGLALPVPR
PLTFGQGRGPIFLDNVECRGQEASLSECGSRGWGVHNCFHYEDVAVLCDEFLHTQPPARK
VLTSIAPPTALQNGRGEGSVRLAGGASPCQGRVEILHGGLWGTVCDDDWGLPDAAVVCRQ
LGCGAALAATTNAFFGYGTGHILLDNVHCEGGEPRLAACQSLGWGVHNCGHHEDAGVLCA
VLSPPTSTALPPSVTKEDWAWHTEPAATGVGALPSRDTIRFTTAAWASGKKSGRLRLVGG
PSPCRGRVEVLYAGGWGTVCDDDWDFADARVACREAGCGPALGATGLGHFGYGRGPVLLD
NVGCTGTEARLSDCFHLGWGQHNCGHHEDAGALCAGPEELGLQVQQDGSETTRMPSPRPR
DGHLRLASGTHRCEGRVELFLGQQWGTVCDDAWDLRAAIVLCRQLGCGQALAALGEAHFG
PGRGPILLDNVKCRGDESTLLLCSHIRWDVHNCDHSEDASVLCQPL
Download sequence
Identical sequences D3ZQH3
ENSRNOP00000001953 XP_017453990.1.100692 XP_017459959.1.4139 RnR255 ENSRNOP00000001953 10116.ENSRNOP00000001953

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]