SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017466214.1.95384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017466214.1.95384
Domain Number 1 Region: 135-584
Classification Level Classification E-value
Superfamily Sema domain 4.19e-130
Family Sema domain 0.0000481
Further Details:      
 
Domain Number 2 Region: 945-1042
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000586
Family Other IPT/TIG domains 0.0081
Further Details:      
 
Domain Number 3 Region: 1455-1583
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 0.000000000000432
Family p120GAP domain-like 0.018
Further Details:      
 
Domain Number 4 Region: 587-638
Classification Level Classification E-value
Superfamily Plexin repeat 0.00000000000209
Family Plexin repeat 0.0023
Further Details:      
 
Domain Number 5 Region: 1039-1127
Classification Level Classification E-value
Superfamily E set domains 0.0000000000331
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.045
Further Details:      
 
Domain Number 6 Region: 1146-1227
Classification Level Classification E-value
Superfamily E set domains 0.00000049
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017466214.1.95384
Sequence length 1736
Comment PREDICTED: plexin-A2 isoform X3 [Rhagoletis zephyria]; AA=GCF_001687245.1; RF=representative genome; TAX=28612; STAX=28612; NAME=Rhagoletis zephyria; AL=Scaffold; RT=Major
Sequence
MRFIIWFLLAFMLNYVTSIGSFNTQSSQIRSTSRINDNSHSSTEILFTRTLLDAAHGHSS
QTLLNDEEDILENSDGVIDGFTSASLKLALTGNGGGSAPSASALSHSQFGGEEVKDVHER
SSADTKNYSSIITSAIHFDTPLNHLVVDTFTGRVFVGGVNFLYQLSPELELHEKVKTGPR
NDSVECTVLDCPAHAMRRPTDNYNKVLLIDRATSRLIACGSLFQGTCTVRNLQNVSIVEQ
DLPDAVVANDANSSTVAFIAPGPPQPPITNVMYVGVTYTNNSPYRSEIPAVASRSLEKTK
MFQIASSAVTTGTRTFINSYAREGYLINYVYGFSSERFSYFLTTQLKHNYHSSPKEYITK
LVRICQEDSNYYSYTEIPIDCITGGTKYNLVQAGYLGKPSADLAGSLGITVQDDVLYGVF
SVGDGNVSTDNSALCIYSLKSIRRKFMQNIKSCFNGVGSRGLGFISPNMPCVPTKLQTIG
EDFCGLDVNSPLGGEQPIAVVPVAMFNTRLTAVAATSTSGYTVVFIGTSKGYLKKVVVES
ADSANEYANIPIKVGSAINPDMHFDSRNLYIYVMSRNEVAKVKVYDCSDYGTCGECLGAR
DPYCGWCSLENKCSPRSSCQDDANDPLYWISYKTGKCTTITSVVPHQLQRTTARTLELII
DHLPQLKENLVCAFTTEEKALFTNATKKRNGVNCTTPRTDMLPQIEQGKHHFTAKLSVRT
KDGPDLVSTDFTFFDCSTHSSCTRCVSSEFPCDWCVEAHRCTHDTAENCRNDILVTGVSR
IGPSYRSGPGFCPTINATGEGSEMLVAAGTSKSIKVKVHIIGQFIVQTRFVCQFNIEGRV
TSLNAQLLGDTIYCDNMEFQYTSRSPNLTATFAVIWGGSKPLDNPHDIHVVIYRCRDMAD
SCGMCLALAEKYNCGWCSSTNTCEVEEQCNKNNEGKTDWLNRMETCPNPEIHSFYPKTGP
WEGGTNITIRGINLGKNFTDIYSGVRIAGISCMPFQQYYIDTKEIVCNVDSPGVQLYRNG
RIVVQIGDYRGESKEDYEFVDPKITNFSPQYGPVSGGTHVRIIGKYLNAGSRIQSFINEH
LPCEIMSVDVTQAICRTAPSPGIIEGRLKMLFDNGQREFNEYNFKYVLDPTIEQVSSGPS
GQLKVPRGIPAGGIEIAVAGTQFNFIQSPRMYVYYKNKVFYSQCKVESATEMICFSPVIA
TDNDVLDAEKPELLEYGFLMDNVLRVQNLSSKHKNHFELYPNPLYYNFEEHIKYYKSEYL
TINGRNLDRACKETDVVVRIGKGICNITSLSRQQLTCRPPPESATESSNEPGPEVIVRIG
QSLEYRIGVLSYASPNLMHDLSKNVLLVIGSGTVVILIIFVALLVAYKKKTSESNRVLRN
MQEQMDILELRVAAECKEAFAELQTEMTDLTGDLTSGGIPFLDYRTYAMKILFPNHEDHI
VLQWERPELLRKEKGLRLFGQLIMNKTFLLLFIRTLESNRYFSMRERVNVASLIMVTLQS
KLEYCTDILKTLLGDLIEKCIEGKSHPKLLLRRTESVAEKMLSAWFTFLLYKFLKECAGE
PLYMLFRAVKGQVDKGPVDACTHEARYSLSEEKLIRQLIDFRPMTVYASIIQQPIFCNSI
DMMPTHTENVPVKVLDCDTIGQVKEKCLDTIYRNIPWSQRPRKDDLDLEWRTGASGRVIL
YDEDTTSKTESEWKKLNTLQHYNVPDGAGLSLVPKQSSNYNFSILSDKNEKCHKKI
Download sequence
Identical sequences XP_017466214.1.95384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]