SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017476544.1.95384 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017476544.1.95384
Domain Number 1 Region: 735-873
Classification Level Classification E-value
Superfamily Toll/Interleukin receptor TIR domain 1.7e-38
Family Toll/Interleukin receptor TIR domain 0.00013
Further Details:      
 
Domain Number 2 Region: 148-444
Classification Level Classification E-value
Superfamily L domain-like 2.21e-28
Family Ngr ectodomain-like 0.017
Further Details:      
 
Domain Number 3 Region: 520-661
Classification Level Classification E-value
Superfamily L domain-like 3.16e-19
Family Ngr ectodomain-like 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017476544.1.95384
Sequence length 903
Comment PREDICTED: protein toll-like [Rhagoletis zephyria]; AA=GCF_001687245.1; RF=representative genome; TAX=28612; STAX=28612; NAME=Rhagoletis zephyria; AL=Scaffold; RT=Major
Sequence
MCDLKDCSADILHLSGFFNTTEELFSNNCETEVLTKHGILFFPTAKQGEYLKKVYPKKSE
LTMKNCLQTPTTWRQAKLSYNVLVKIDRHTMGFSKSHHQWDVFVTAGPSRGFLPVKLTLD
LNELEYLEVRLICTGYADVALPVDVFHALHSVENLILHVSDKAGGVAAWRNLTATHFRDL
QKLKHLDLAGNRMRTLTVDLFTPLPKLLHLNLSFNALQSLPAELLVAQQELITLDLSGNE
LEALPRNFFKNTKWLQELHLAHNRLSVPTNVIENVGGLFSLRQLDLSHNRFEDLLGSGVY
ENTTLLAGPQYQPFDRVVYLDRDMTINLSHNRITRFSFDWVENVYDCNYHYDLSHNNITH
VPFLAAATFKTPENCQRKWTLAHNPLQCDCQMSWLAXYHYDLSHNNITHVPFLAAAPFKT
PENCQRKWMLAHNPLQCDCQMSWLAINTHNFEADDWQCAAPSPLLTRLPITLTRAELCSW
TPNVCPSECTCNYDSTELIVNCSATQLVEVPPIPRPEQVGLLNCSATQLVEVPPIPRPEQ
VGLRSTSLYLNNNTIYQLPRNTIFGYANVSRLYVAHNRLITITPSHLPTNLTILDLRGNQ
LEHLSDDFLLTYLSENGTLKQLYLSNNPWLCDCAAELLLRAVRIQSARIPDASMLICANL
PNVSLKSVDFAQVCASVDMQRSALFIALLTLALMVIVLISGIALFYKYNLQVKIWLYAHH
IELCSIDEQAGNEMNKKFDAFISYAHQQQDYVNRVLLPGLERGVPPFRICIHERNWLVGA
YIPEQIVESVEQSRRTIIVLSQQFVESDWGRMEFRMAHQCALNEERARIIIIKYGELTNI
AGLDKELQAYLHMNTYLEWNDPRFWQKLRYAMPHKSSEMKQAGMLQLPSRVRFQPGEQLH
WLR
Download sequence
Identical sequences XP_017476544.1.95384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]