SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017496645.1.32401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017496645.1.32401
Domain Number 1 Region: 38-97
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.0000000000000824
Family HLH, helix-loop-helix DNA-binding domain 0.004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017496645.1.32401
Sequence length 134
Comment PREDICTED: DNA-binding protein inhibitor ID-2 [Manis javanica]; AA=GCF_001685135.1; RF=representative genome; TAX=9974; STAX=9974; NAME=Manis javanica; AL=Scaffold; RT=Major
Sequence
MKAFSPVRSVRKNSLSDHSLGISRSKTPVDDPMSLLYNMNDCYSKLKELVPSIPQNKKVS
KMEILQHVIDYILDLQIALDSHPTIVSLHHQRPGQSQASRTPLTTLNTDISILSLQASEF
PSELMSNDSKALCG
Download sequence
Identical sequences A0A1S2ZP00 F6TGB5 M3X559 M3YP23 U6CN69
ENSECAP00000006728 9796.ENSECAP00000006728 XP_001503661.1.31192 XP_003984563.1.62641 XP_004401865.1.74151 XP_004436504.1.5094 XP_004745805.1.14098 XP_006191904.1.101512 XP_006197156.1.17985 XP_006745001.1.47382 XP_007098277.1.5354 XP_007522312.1.11023 XP_008515849.1.77740 XP_010962346.1.22495 XP_010980977.1.51371 XP_014722266.1.49734 XP_014936610.1.86478 XP_017496645.1.32401 XP_017496646.1.32401 XP_019308223.1.44245 XP_019308234.1.44245 XP_021553082.1.83697 ENSECAP00000006728 ENSMPUP00000013080 ENSFCAP00000021760 ENSMPUP00000013080

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]