SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017499169.1.32401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017499169.1.32401
Domain Number 1 Region: 112-608
Classification Level Classification E-value
Superfamily Sema domain 3.66e-100
Family Sema domain 0.0023
Further Details:      
 
Domain Number 2 Region: 1472-1597,1763-1920
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.81e-34
Family p120GAP domain-like 0.03
Further Details:      
 
Domain Number 3 Region: 1040-1130
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000129
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.039
Further Details:      
 
Domain Number 4 Region: 949-1041
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000916
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 5 Region: 1127-1208
Classification Level Classification E-value
Superfamily E set domains 0.000000000014
Family Other IPT/TIG domains 0.064
Further Details:      
 
Domain Number 6 Region: 611-663
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000144
Family Plexin repeat 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017499169.1.32401
Sequence length 1987
Comment PREDICTED: plexin-D1 [Manis javanica]; AA=GCF_001685135.1; RF=representative genome; TAX=9974; STAX=9974; NAME=Manis javanica; AL=Scaffold; RT=Major
Sequence
MAALPSGDRMLHEFCTARGRRRSTTLRSEGRRGLERPRVSGGRAPAQGPARASAAKPGGT
AGCPPPPQAGRRERRVPPGTRAGAEPQRPRFQPRGPEREPTGGSGLAPAPIQRRFPSPTP
TNNFALDGAAGTVYLAAVNRLYQLSGANLSLEAEAAVGPVADSPLCHAPQLPQASCEHPR
RLTDNYNKILQLDPGQGLVVVCGSIYQGFCQLRRRGNISAVAVHFPPAAPPAEPVTVFPS
MLNVAANHPNASTVGLVLPPAAGAGGSRLLVGATYTGYGSAFFPRNRSLEDHRFENTPEI
AIRSLDARGDLAKLFTFDLNPSDDNILKIKQGAKEQHKLGFVRAFLHPADPPPGAQSYAY
LALNSEARAGDKESQARSLLARICLPRGAGGDAKKLTESYIQLGLQCAGGAGRGDLYSRL
VSVFPARELLFAVFERPQGPPTGRAAPAALCAFRFADVQAAIRAARTACFVEPAPDVVAV
LDSVVQGTGPACERKRNIQLQPEQLDCGAAHLQHPLSILQPIKATPVFRAPGLSAVAVAR
VSNYTVVFLGTVSGRLLKINLNENMQVVSRRLVTVAYGEPVHHVMQFDPADPRYLYLMTS
HQMVRVKVAACAMHATCGDCVGAADAYCGWCALETRCTVQQDCANSSRPRFWTSANEGPS
RCPAMTVLPAEIDVRQEYPGMILQISGSLPSLSGMEMACDYGNNIRTMARVPGPAFGHQI
AYCNLLPRDQFPPFPPHQDHVAIEMSVRVNGRNIVRANFTIYDCSRIGQVSPHTACTSCL
SAPWPCFWCIQQHACVSNQSRCEASPNPMSPPDCPQTLPSPLAPMPTGGSQSFLVRLASA
AFFQGEALECSFGPEEIFEAVWVNESAIRCNQVVLHTTQRSQVFPLSLQLKGQPARFLDS
PDPMTVEVYNCATGSPDCSQCLGREDLGHLCMWSDGCRLRGPLQTLPGTCPAPEIRTIEP
LSGPLDGGTLLTIRGRNLGRRLSDVAHGVWIGSVTCEPLADRYTVSEEIVCATGPAPEVF
SDVVTVNASKEGTSRERFSYVLPLVHSLEPAVGPKAGGTRITIHGSDLHVGSELQVLVNN
TEACTDLVRTDTSIACTVPEGSLPVPVPVCVRLERRGCVSGNLTFWYMQNPIITAISPRR
SPVSGGRTITVAGERLHMVQNVSMAVHHIGREPTLCKVLNSTLITCPSPGALSNASAPVD
FFINGRAYADEGAMAEELLGPEEAQRGSRFRLDYLPNPQFSTAKREKWIKHHPGEPLTLV
IHKEQDSLGLESYEYQVKIGQVACDIQIVSDRVIHCSVNESLGTAEGQLPITIQVGNFNQ
TIATLQLGGSETAIIVSIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQI
REEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEESYVLPSQPL
NSQGSSPAQETHPLLGEWKIPESCRPNMEEGISLFSSLLNNKHFLIVFVHALEQQKDFAV
RDRCSLASLLTIALHGKLEYYTGIMKELLVDLIDASATKNPKLMLRRTESVVEKMLTNWM
SICMYSCLRETVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNL
NVSFQGCGMDSLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFASSTQSY
ILRDLDDTSVMEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVL
PTDELAEPKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVK
YFFDFLEEQAEKRGISDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIDKTDHIDACLSVI
AQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQIHDMTPLSEQEMNAHLA
EESRTYQNEFNTNVAMTEIYKYAKRYRSQIMTALEANPTARRTQLQHKFEQVVALMEDNI
YECYSEA
Download sequence
Identical sequences XP_017499169.1.32401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]