SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017504694.1.32401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017504694.1.32401
Domain Number 1 Region: 18-173
Classification Level Classification E-value
Superfamily TRADD, N-terminal domain 7.06e-65
Family TRADD, N-terminal domain 0.000000169
Further Details:      
 
Domain Number 2 Region: 220-308
Classification Level Classification E-value
Superfamily DEATH domain 0.00000000000000283
Family DEATH domain, DD 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017504694.1.32401
Sequence length 311
Comment PREDICTED: tumor necrosis factor receptor type 1-associated DEATH domain protein isoform X3 [Manis javanica]; AA=GCF_001685135.1; RF=representative genome; TAX=9974; STAX=9974; NAME=Manis javanica; AL=Scaffold; RT=Major
Sequence
MEYADWPGKMTVEPKGLEKWVGSAYLFVESSLDKVVLSDAYAHPQQKMAVYRALRTALAE
IGGSPDVPQMLKIHRNDPQLIVQLRFCGRQLCGRFLRAYREGALHAVLQGCLAAVLALRS
VPLQLELRAGAERLDALLADEERCLSCIFAQKPDRLRDEELAELEDAFQSLTCSSGSQGG
DVEVAPAPTPSEKPPSSGQTFLFQGQPVVNRPLSLQDQQTFARSVGLKWRKVGRSLQRGC
PALRDPALDSLAYEYEREGLYEQAFQLLRRFVQAEGRRATLQRLVEALEENELTSLAENL
LGLVNPDGGLA
Download sequence
Identical sequences XP_017504692.1.32401 XP_017504693.1.32401 XP_017504694.1.32401 XP_017504695.1.32401 XP_017504696.1.32401 XP_017504697.1.32401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]