SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017524413.1.32401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017524413.1.32401
Domain Number 1 Region: 128-553
Classification Level Classification E-value
Superfamily Sema domain 4.71e-101
Family Sema domain 0.00026
Further Details:      
 
Domain Number 2 Region: 1451-1578,1773-1930
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 9.42e-38
Family p120GAP domain-like 0.038
Further Details:      
 
Domain Number 3 Region: 1006-1095
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000102
Family Other IPT/TIG domains 0.041
Further Details:      
 
Domain Number 4 Region: 914-1009
Classification Level Classification E-value
Superfamily E set domains 0.000000000000728
Family Other IPT/TIG domains 0.017
Further Details:      
 
Domain Number 5 Region: 556-608
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000641
Family Plexin repeat 0.0019
Further Details:      
 
Domain Number 6 Region: 1094-1138,1176-1229
Classification Level Classification E-value
Superfamily E set domains 0.000000574
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017524413.1.32401
Sequence length 1992
Comment PREDICTED: plexin-B3 isoform X1 [Manis javanica]; AA=GCF_001685135.1; RF=representative genome; TAX=9974; STAX=9974; NAME=Manis javanica; AL=Scaffold; RT=Major
Sequence
MPRGSVLPGGVPLELKGQCPPRLSCACHHCPGAAETRRRASVGATPLGGPFCCSPSQRPP
LSAHRPPALSSTVSPLSLRALLSAFFWLFRIRPHSAPVMAPWPPFSPHVLLVLLQLLCPV
LPLTQAHHFSAPNTTFNRLALAPGQGTLYVGAVNRLFQLSPQLQLKSMAVTGPVFDSPDC
VPFHDPAECPQARLTNNANQLLLVSSRSRELVACGQVRQGVCEKRSLEDVAKVLYQAEDP
GDGQFVAANTPGVATVGLVVPAPGRDLLLVARGLAGKLSGGVPPLTVRQLAGPQPFSSEG
LGRLVVGDFSDYNNSYVGAFADTHFAYFVFRRRGARAQAEYHSYVARVCLRDANLYSYVE
VPLTCQGQGLIQAAFLTPGTLLGTFAAGPRGAQAALCAFPLAELHGSMEQARRLCYTAGG
RSPSGKEEATVEYGVTSRCVTLPPDSPESYPCGDEHTPSPIAGRQPLEARPLLRLGQPIS
AVAALQADGYTIAFLGDTQGQLHKVFLNGSQGQVYHSQQVGPPGSAVSRDLLVDGSGNHL
YVLTAQQVDRVPVAACPQFSDCTSCLQARDPLCGWCVLQGRCTRKAQCGQAAQPSRWLWS
CEENSHCPHIQSLLPTHHPRQEQGQVTLSVSRLPTLATDEYLHCAFGDYDSLAHVEGSHV
TCVTPPQDQLPLNPPGTDHITLPLALMFEDVAVAVTDFSFYDCSAVQALGAAAPCRACVG
SLWQCHWCPQSSRCTYGEHCPEGERTIYSAQEVHTQVRGPGACPRVEGLAGPPLVPVAWE
SRLALRVRNLQHFRGLPGSYHCWLELPGELQRLPASLEETVGDAGLIYCQAHQFHPSMAQ
QELPVPIYVTRGEGQRLDNAQTLHVTLYDCAAGHPDCSHCQAANRTLGCVWCSHNQPTCR
YGPLCPPGTVQLLCPTPSIDMIEPLTGPPEGGLALTILGSNLGRDFADVQGAVSVAGRPC
SPDPFLYRISARIVCVTSPAPSGTTGPIQVAIESRPPGISTQHFTYQDPILLSLSPRWGP
QAGGTQLTIRGQHLQTGGNISAFVGSQPCPIQEPVCPEAIVCHTMPQANPGEAVVRVVFG
HAQRTLLTSPFRYTANPQLVVAEPSVSFRGGGRLIRVRGTGLDVVQQPLLSVWLEAEEVM
QAAGTPPWNPSPRKSCSAPAAAPRACVQVGGGLLQCSTICSVNSSSLLLCQSPAVLDGAR
PLRVFFTLDNMHVDFASTNGGQDFLYQPNPRLVPLSREGPARPYRVKPGNVLDVEGEGLS
LGISKEEVRVQIGNGECLVKTLTLTHLYCEPPPQAPQPVNGSSTLPRFVVQMGNVRLDLG
PVQYEAEPVLSAFPVEAQVGLGVGAAVLVAAVLLLTLMYRHKSKQALRDYQKVLVQLENL
EIGVGDQCRKEFTDLMTEMTDLSSDLEASGIPFLDYRTYAERVFFPGHGSCPLQPTFEGP
GEEGRRAPLCQGLTQLSNLLNSKLFLLTLVRTLEEQPSFSQRDRCHVASLLSLALHSKLE
YLTDIMRTLLGDLAAHYVHKNPKLMLRRTETMVEKLLTNWLSICLYAFLREVAGEPLYML
LRAIQYQVDKGPVDAVTGKAKRTLNNSRLLREDVEFRPLTLMVLAGPEVAGATGSSMVQR
VPARVLDTDTITQVKEKVLDQVYKGTPFSQRPSVHALDLEWRSGLAGHLTLSDEDLTSVT
QNHWKRLNTLQHYKVPDGATVGLIPQLHNGGAISQSLAQSCPFGENIPMLEDSEEGGVHV
WHLVRATEEPEGAKVRRGSLRERERAQAKAIPEIYLTRLLSMKGTLQKFVDDAFQAILSV
NRPVPIAVKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFWVNTLKNPQLIFDVRVSD
NVDAILAVIAQTFMDSCSISEHKVGRDSPVNKLLYAREIPRYKQMVERYYCDIRQSSPAS
YQEMNSALAELSGNYTSAPHCLEALQELYKHIHRYYDQIISALEADPVGQKMQLACRLQQ
IAALVENKVTDL
Download sequence
Identical sequences XP_017524413.1.32401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]