SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017524806.1.32401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017524806.1.32401
Domain Number 1 Region: 216-667
Classification Level Classification E-value
Superfamily Sema domain 1.83e-114
Family Sema domain 0.0002
Further Details:      
 
Domain Number 2 Region: 1779-1904,2091-2276
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.8e-40
Family p120GAP domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 1246-1341
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000462
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 1338-1428
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000644
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 5 Region: 670-719
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000061
Family Plexin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 1427-1471,1499-1552
Classification Level Classification E-value
Superfamily E set domains 0.0000000014
Family Other IPT/TIG domains 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017524806.1.32401
Sequence length 2310
Comment PREDICTED: plexin-B1 isoform X1 [Manis javanica]; AA=GCF_001685135.1; RF=representative genome; TAX=9974; STAX=9974; NAME=Manis javanica; AL=Scaffold; RT=Major
Sequence
MWVVLQKSLLGDCVCACVRSWSQHVCAGCVSVCLCVQAQMCLCRVCAHGLGGACASVRLC
AGGSRARAAPGLSRGVHLEPRGVGFGKRGQKEGEEGLQGACQPPAPPSRPFPGPEDAWPC
CLPSLGGSKEAPPVECVWWPRARLGSGKGSPACCRPAAQLCALLSPWPGDAHTDHAAASR
PSRPCQVTMPALGPAILQALWAGWVLSLQHPQPAAFTANGTRLQHVVRDPTSGTLYLGAT
NFLFQLSPGLQLEATVATGPVLDSRDCLPPVVPDECPHAQPTNNPNQLLLVSPGALVVCG
SVHQGVCEQRRLGRLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGPAGGPLLFVGRGY
TSRGLGGGIPPITTRTLWPPDPQTAFSYEETAKLAVGRLSEYSHHFVSAFRHSASAYFLF
LRRDLRAPSRAFRAYVSRVCLRDQHYYSYVEVPLACQEARYRLVQAAAVAPPREGTQGQA
LFVAFSVAAPPVVGRPPVAAAGPSGASALCAFPLDEVDRLANHTRDACYTRGGRAEDGQE
VAYIEYDVSSSCAQLPMDTVDAYPCGSDHTPSPMASQVPLEAMPVLEWPGVQLTAVAVAV
EDGHTIVFLGDSEGHLHKVYLGPGSDGHPYSTQSIWQGSAVSRDLLFDGPLEHLYVLTQH
TLLKVPVASCAQHLDCVSCLAHRDPHCGWCVLLGRCGRRSECSRGRGPEPWLWSFQPGPG
CLQVAALIPASISREERRELFLAVPGLPPLWPGESYSCHFGEHRSPALLTGSGVTCSSPG
PKEAPPLPKGVDHLSMGVELRFGAVSIAKASLLVYDCVAIPELHPTAQCQACVSSRWGCK
WCVWQHVCTHKASCDAGPMVASQQSPLLSPDPSAEDVPTPSPPAAPEVTGTPAPDTPPEE
PGAPATATATATATRVPAAARPSLLSPFPTLASTEPPLHEGPPPPSNPRPGTAIQPTGLR
PTAQDPLASHSAPSGAAAGTPADPGAKARPTAAPPDQPPSTAPATAFPGAAGSTKPALTW
SERGGGELPEADPWTGGDTPALSTPTLLSGDGDSAEHEGPPAPVILPSSLDYQYDSPGLW
ELGEVGCGASACPCVESIQGSELIPVLVAQEVQLLGRNLRLFQDSPGDSKCVMELEDREV
VLEAQVECELPPGDQCHVTCQQHQLSYEALQPELRVGLFLRWAGSLRVDGADGLHVVLYD
CSVGHQDCSRCQTAKPQYDCVWCMGVHPRCTARKACGRPGAVATQCPAPLILSVEPLTGH
IHGGTRVTIRGSDLGQHVQDIRDTVTVAGVPCAVDTQEYQVSSRLVCITASAGKEVAGAV
TVEVPGRGRGVSEHLFAYQDPKVLSISPARGPRAGGTRLTLHGSSLLTGRLEDIRVVVGD
QPCCLLPEPRAERLQCETGPQHTPAVLPVAVWFGAVEQRLQSQFQYTADPNVTSAGPTKS
FVSGGRVVRVRGQNLDVVQTPRMRVAVQALQPSEGQEQRRRVEPEAACSLGACSGGRHFE
EPCLVASSRLITCPTPALLGLPTDPWVRVEFILDNLVFDFTTLSPTPFSYEADPTLQPLN
PEDPTRPFRHKPGSVLSVEGDNLDLAMSKEEVLAMIGDGPCVVKTLTRHHLYCEPPEEQP
LAQHHPLQGAPDPLPEFTVDMGNLHFSLGRVQYDSEGPVAFPVAAQVGLGVGASLLALGV
SVIVLMYRRKSKQALRDYKKVQIQLENLESSVRDRCKKEFTDLMTEMTDLTSDLLGSGIP
FHDYRVYAERVFFPGHRESPLHRDLGVPESRRPTVEHGLGQLSHLLNSKLFLTKLIHTLE
SQRTFSARDRAYVASLLTVALHGKLEYLTDILRTLLTDLVAQCVARNPKLMLRRTETVVE
KLLTNWMSICLYTFVRDAVGEPLYMLFRGIKHQVDKGPVDSVTGKAKYTLNDNRLLREDV
EYRPLTLNALLAVGPGAGEAPGVSVKVLDCDTISQAKEKMLDQLYKGVPLTQRPDARTLD
VEWRSGVAGHLVLSDEDVTSEAQGLWRRLNTLQHYKVPDGATVALVPCLTKHVLRESQDY
VPRESTPMLEDVDEGGIRPWHLVKPSEEPEARPRRGSLRGGERERAKAIPEIYLTRLLSM
KGTLQKFVDDLFQVTLSTGRSVPLAVKYFFDLLDEQAQQHGIADQDTVHIWKTNSLPLRF
WINIIKNPQLVFDVQTSDSVDAVLLVIAQTFVDACTLADHKLGRDSPINKLLYARDIPRY
KQMVERYYADIRQAVPTSDQEMNSVLAELSRNHSGGLGAGVALHELYKYINRYYDQIITA
LEEDGVAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences XP_017524806.1.32401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]