SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017524807.1.32401 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017524807.1.32401
Domain Number 1 Region: 216-574
Classification Level Classification E-value
Superfamily Sema domain 2.09e-85
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1686-1811,1998-2183
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.65e-40
Family p120GAP domain-like 0.019
Further Details:      
 
Domain Number 3 Region: 1153-1248
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000434
Family Other IPT/TIG domains 0.011
Further Details:      
 
Domain Number 4 Region: 1245-1335
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000616
Family Other IPT/TIG domains 0.028
Further Details:      
 
Domain Number 5 Region: 577-626
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000593
Family Plexin repeat 0.003
Further Details:      
 
Domain Number 6 Region: 1334-1378,1406-1459
Classification Level Classification E-value
Superfamily E set domains 0.00000000129
Family Other IPT/TIG domains 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017524807.1.32401
Sequence length 2217
Comment PREDICTED: plexin-B1 isoform X2 [Manis javanica]; AA=GCF_001685135.1; RF=representative genome; TAX=9974; STAX=9974; NAME=Manis javanica; AL=Scaffold; RT=Major
Sequence
MWVVLQKSLLGDCVCACVRSWSQHVCAGCVSVCLCVQAQMCLCRVCAHGLGGACASVRLC
AGGSRARAAPGLSRGVHLEPRGVGFGKRGQKEGEEGLQGACQPPAPPSRPFPGPEDAWPC
CLPSLGGSKEAPPVECVWWPRARLGSGKGSPACCRPAAQLCALLSPWPGDAHTDHAAASR
PSRPCQVTMPALGPAILQALWAGWVLSLQHPQPAAFTANGTRLQHVVRDPTSGTLYLGAT
NFLFQLSPGLQLEATVATGPVLDSRDCLPPVVPDECPHAQPTNNPNQLLLTAFSYEETAK
LAVGRLSEYSHHFVSAFRHSASAYFLFLRRDLRAPSRAFRAYVSRVCLRDQHYYSYVEVP
LACQEARYRLVQAAAVAPPREGTQGQALFVAFSVAAPPVVGRPPVAAAGPSGASALCAFP
LDEVDRLANHTRDACYTRGGRAEDGQEVAYIEYDVSSSCAQLPMDTVDAYPCGSDHTPSP
MASQVPLEAMPVLEWPGVQLTAVAVAVEDGHTIVFLGDSEGHLHKVYLGPGSDGHPYSTQ
SIWQGSAVSRDLLFDGPLEHLYVLTQHTLLKVPVASCAQHLDCVSCLAHRDPHCGWCVLL
GRCGRRSECSRGRGPEPWLWSFQPGPGCLQVAALIPASISREERRELFLAVPGLPPLWPG
ESYSCHFGEHRSPALLTGSGVTCSSPGPKEAPPLPKGVDHLSMGVELRFGAVSIAKASLL
VYDCVAIPELHPTAQCQACVSSRWGCKWCVWQHVCTHKASCDAGPMVASQQSPLLSPDPS
AEDVPTPSPPAAPEVTGTPAPDTPPEEPGAPATATATATATRVPAAARPSLLSPFPTLAS
TEPPLHEGPPPPSNPRPGTAIQPTGLRPTAQDPLASHSAPSGAAAGTPADPGAKARPTAA
PPDQPPSTAPATAFPGAAGSTKPALTWSERGGGELPEADPWTGGDTPALSTPTLLSGDGD
SAEHEGPPAPVILPSSLDYQYDSPGLWELGEVGCGASACPCVESIQGSELIPVLVAQEVQ
LLGRNLRLFQDSPGDSKCVMELEDREVVLEAQVECELPPGDQCHVTCQQHQLSYEALQPE
LRVGLFLRWAGSLRVDGADGLHVVLYDCSVGHQDCSRCQTAKPQYDCVWCMGVHPRCTAR
KACGRPGAVATQCPAPLILSVEPLTGHIHGGTRVTIRGSDLGQHVQDIRDTVTVAGVPCA
VDTQEYQVSSRLVCITASAGKEVAGAVTVEVPGRGRGVSEHLFAYQDPKVLSISPARGPR
AGGTRLTLHGSSLLTGRLEDIRVVVGDQPCCLLPEPRAERLQCETGPQHTPAVLPVAVWF
GAVEQRLQSQFQYTADPNVTSAGPTKSFVSGGRVVRVRGQNLDVVQTPRMRVAVQALQPS
EGQEQRRRVEPEAACSLGACSGGRHFEEPCLVASSRLITCPTPALLGLPTDPWVRVEFIL
DNLVFDFTTLSPTPFSYEADPTLQPLNPEDPTRPFRHKPGSVLSVEGDNLDLAMSKEEVL
AMIGDGPCVVKTLTRHHLYCEPPEEQPLAQHHPLQGAPDPLPEFTVDMGNLHFSLGRVQY
DSEGPVAFPVAAQVGLGVGASLLALGVSVIVLMYRRKSKQALRDYKKVQIQLENLESSVR
DRCKKEFTDLMTEMTDLTSDLLGSGIPFHDYRVYAERVFFPGHRESPLHRDLGVPESRRP
TVEHGLGQLSHLLNSKLFLTKLIHTLESQRTFSARDRAYVASLLTVALHGKLEYLTDILR
TLLTDLVAQCVARNPKLMLRRTETVVEKLLTNWMSICLYTFVRDAVGEPLYMLFRGIKHQ
VDKGPVDSVTGKAKYTLNDNRLLREDVEYRPLTLNALLAVGPGAGEAPGVSVKVLDCDTI
SQAKEKMLDQLYKGVPLTQRPDARTLDVEWRSGVAGHLVLSDEDVTSEAQGLWRRLNTLQ
HYKVPDGATVALVPCLTKHVLRESQDYVPRESTPMLEDVDEGGIRPWHLVKPSEEPEARP
RRGSLRGGERERAKAIPEIYLTRLLSMKGTLQKFVDDLFQVTLSTGRSVPLAVKYFFDLL
DEQAQQHGIADQDTVHIWKTNSLPLRFWINIIKNPQLVFDVQTSDSVDAVLLVIAQTFVD
ACTLADHKLGRDSPINKLLYARDIPRYKQMVERYYADIRQAVPTSDQEMNSVLAELSRNH
SGGLGAGVALHELYKYINRYYDQIITALEEDGVAQKMQLGYRLQQIAAAVENKVTDL
Download sequence
Identical sequences XP_017524807.1.32401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]