SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017561214.1.86671 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017561214.1.86671
Domain Number 1 Region: 157-631
Classification Level Classification E-value
Superfamily Sema domain 8.76e-93
Family Sema domain 0.0014
Further Details:      
 
Domain Number 2 Region: 1497-1620,1787-1939
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.77e-33
Family p120GAP domain-like 0.028
Further Details:      
 
Domain Number 3 Region: 971-1064
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000202
Family Other IPT/TIG domains 0.069
Further Details:      
 
Domain Number 4 Region: 1061-1153
Classification Level Classification E-value
Superfamily E set domains 0.0000000000498
Family Other IPT/TIG domains 0.039
Further Details:      
 
Domain Number 5 Region: 634-686
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000244
Family Plexin repeat 0.0016
Further Details:      
 
Domain Number 6 Region: 1153-1229
Classification Level Classification E-value
Superfamily E set domains 0.00000000653
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017561214.1.86671
Sequence length 2011
Comment PREDICTED: plexin-D1 [Pygocentrus nattereri]; AA=GCF_001682695.1; RF=representative genome; TAX=42514; STAX=42514; NAME=Pygocentrus nattereri; AL=Scaffold; RT=Major
Sequence
MHHPNNTCSVGVLEVVLVIRLIGGLKQHVLALTGHAGGRGGPSRRSALPLLSLALLCKGS
ARLLLPSFRSELSGRKPTASFSSPPARTRRELTSLDARARAEERAAQASSDGIIMSRTAA
RVPRAAVACPSLPAALLLLLLAAASLTRAAGALRVRQAFSSPSETNNFAVDATSRRVYVG
AVNALYQLSGALAPEAEQRTGPVSDSALCHAPQLPHAPCEHARALADNHNKLLALDGAQG
VLVACGSVHQGFCELRSLENVTRVAVSFPPQDAAVFPSMLNVAANHANASTAGLVFRVRG
GHRVSARLLVAATYTGAGSDFFPRNLSREDLRFENTPEIAIRALDASDPTRLFTYDINPS
EDNVLKIKQEAKARNKLSFVRAFAENTYAYVAMNRDGAGGAKESEPNSVLARICLDAEVP
SKTAEARKLTESYVQMGLQCGAGGNVYGRLVSVFAAEPYLFAVFARAGSRRTALCAFRFA
DVEKRIHEARRNCSSGPNGDVRVLDSVIQGSGAECEAKGVRHLQPEQLNCGAAHLQHPLA
LQKPLRATPLYEAPGLSSVAVEDVHNHTVVFLGTSNGWLRKLSLLGNFSVANQWSLRLAA
GESVHHVMTFDPNDRNYLYLMTTHHIFRVQVAVCDQYTSCSDCLSASDAYCGWCTLESRC
SIQEECSTGGVARSWISIREGPQQCPSMTFTPAELSRTANITNVGILVDGSVPDLDGLDL
ECDYGVGIATVATVHLDDGTAKIQTCPLPPASKRPEIPFGKDHIVVPVAIKVNGTSVVSG
NFIIYDCERTGEIHRKTACTSCLSTKWRCYWDQQQNSCVSDKDKAQGLVLENAADCPSVL
HQEFPPWPTGITQDVTLRLSNVEQDTQLNCDFGNGQSYKAHWLDGQSAVKCSGVTLSTTQ
RSELFYLTLKKSGEEKYIDSPRPVTVEVYSCSGGDSDCSQCWGREQQEHLCAWCENSCRP
RDQCQPIRAHCPDPTVHKVRPLSGPLRGGTLLTVQGRNLGRKAEDVEVYIGDVPCNLVPE
SYTVSVELVCETGASPKPLKNKVEVRVRENGMGHSTEAFSYVDPRLDNLIPKEGPIAGGT
RLTIMGTSLEAGSAVKVKVNGTQDCGIDKLSDDIIECWMPPAVPDHAEDVSVCVEYDGKP
CESHLSSTFSYKNNPTISDIKPKKSYLSGGRLISVTGQSFDLVQKAKMEVLGVGESNCRI
QSPNLLECPSPAASQSQQVTAQFYLNGILFRGESHASTGLDLEEEEGTHAGLFLFEYVED
PQFYTASKEKLIKHHPGEPLLLVINKGPSQLDLTEEEYSVMIGSDLCDITFNNEQMIYCT
INRTLSSRTGELPVTVRVGNFHKQIAVVQMGGSELAIIVTVAVCCVLLLLCTVALVVYCT
KSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKQFV
TRTFFPKMCSDYERSLVQPVYENDPQGPRALPETHPLLQDWQPSNTARPNMEEGITLFST
LLNNKHFLITFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKELLVDLIDASA
SKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKGSIDAITG
KARYTLNEEWLLRENIEAKPLNINVSFQGFGMDSVSVRVMNTDTICQVKEKILEAFYKNL
PFSQWPREEDVDLEWFPGGGCSSRILQDLDNTSVMEDGRKKLNTVFHYKIPEGASLAMSM
KDKRENTLGRAKDLDTEKYVHLVPLHDELAETKKSHRHSHRKKVLPEIYLTRLLSTKGTL
QKFLDDLFQAILSIPLERPPLAVKYFFDFLEEQADKRGITDPDTLHIWKTNSLPLRFWVN
ILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEIPEYKKR
VQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRTQVVNALDS
NPTARRTQLQHKFEQVIALVEDNIYECCSEA
Download sequence
Identical sequences XP_017561214.1.86671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]