SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017573919.1.86671 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017573919.1.86671
Domain Number 1 Region: 238-425
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 4.85e-26
Family Clostridium neurotoxins, the second last domain 0.04
Further Details:      
 
Domain Number 2 Region: 614-749,782-805
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000931
Family Reprolysin-like 0.042
Further Details:      
 
Domain Number 3 Region: 1419-1485
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000264
Family Complement control module/SCR domain 0.0048
Further Details:      
 
Domain Number 4 Region: 1544-1602
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000792
Family Complement control module/SCR domain 0.0042
Further Details:      
 
Domain Number 5 Region: 520-622,705-798
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.000000824
Family Reprolysin-like 0.057
Further Details:      
 
Domain Number 6 Region: 1478-1540
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000153
Family Complement control module/SCR domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017573919.1.86671
Sequence length 1758
Comment PREDICTED: pappalysin-2 [Pygocentrus nattereri]; AA=GCF_001682695.1; RF=representative genome; TAX=42514; STAX=42514; NAME=Pygocentrus nattereri; AL=Scaffold; RT=Major
Sequence
MFFRLLTVVLIIFHTWLLNSVKSDHIQRYKRSLSVRADRSQAALGQEQCGSVSRRRSYRS
AVRHHQLAALTGRYSRLPDLHHRIARSSCSAGCSLDGSDAFGLRDGPPWESSGQKIQDKS
EREPDKWNAEGRPRLRTDKMLDSSKPGSASAEARAVAWDGKMSTQRIRRSSQWKEKRDRF
FSVRRIPRSPPEIRSERKERPGDVTFEKDIHTSEGSKDYSEERDGQVGPGTEPWGAEVRD
VPPKWMTALYFRGQREQLKVNPTADVELPHSRFTLELWIKPEGGQNNPAIIAGVFDNCSH
AHSERGWSVGVRTIEPTGRKDGRFFFALRTDRALKSTTLTGHQFYQPNVWTHLVARYDGH
RMALFIDGSKIAESRQQSGDLYSPFIKNCRVLLLGGDQSNAGRGFRGYIGGVILWNHARA
REELFKSFIKHSENQRPLLALWADFSDVKQQWIPYKDHHHPTIVAFPAPEQELVSPFQPP
PCGLTTCDNPDVVLSYDQHRQLRAHKRLRYRVVNICADDGSHPTISQQQIQQQHKALEEA
FKPYNLTLELSVLTVHNSSLQRRFILSNCHIAKVGNRHCDHECDHPVTGHDGGDCLRLGT
CYNWMRGDGVCNPECNGIHYDYDDGDCCDPQVTDVTKTCFDPESPERAYLSVKELKELLH
LNTSDILNVFFANNSAREELAGAATWPWAKEALTHQGGMILNPSYFGTVGHSNTMIHEMG
HIFGLYHVFKGVSERESCDDPCQETIASMETGDFCADTAPTPKSKACRDPDPVNDTCGLT
HYHGTPYKNYMSYTDDNCTNHFTPHQVARMHCYIDLVYKNWVQDRKPTPVPLAPMVIGQD
ADSVSIHWLHPISGPLMQREEGVNCQLCDEHGVLHQYAFEATSPHTCDTSGYWTPEEAVG
APDVYQPCEPSMRSWSPEFSLYEANMTSPCPQTEGCVLQLYFQHPVVPDTLTVWITYIST
NSQAISNLEFILETGESVHAGPQQAFCDVPLTLRVNINKKVKGIKICTFDKKLEIDAALL
TSRPQNPLCFSCRMLLYRVLREPPIREDWDPVILKQTTYTDSDVQSGVNYTYMIQVEADG
LLSELSPELIYTHGQHYCGDSRLQGNEECDDGNLLDGDGCSKKCRMEPGFNCVGQPSHCY
IFEGDGVCEEFERGSSIQDCGFFTPEGFVDQWASDASASHQDQRCPALAATGLPDLSQMC
RSQYVEINDALTRSAWIPCTAQSHFNNYYEHSQPVWLRVGFERPGVAASVLIYLAYDGGL
HGEHCWRTVSIQLCDTIGKNHTLGTYELSCQRNPLVVNVTHNLSLPFFQTAAVLLNFSTA
HVAVLGVALRTSCHFSAFTLTGCVRRPCIIGVCSAVNVDHASVNCTPSQDPIRCSVTCRH
GYTLSVLSGLGLHHQERETDLSCENGVWDRVVTCKPVDCGFPDESHVYFASFSCPWGTTF
GKQCTFSCNSPAVLQGESDTLDCLEDGLWSFPEAYCKIECLDPPVVPNAKLLPSQCEGSR
HDLGTVCRYKCSPGYFVTSLSKKTKKRFLRLECLEGGRWQEGGCSPVSCPALPAMFEGMY
TCTTHLDFDSVCTLHCPDASERHTIRCTKDGRWTEDFSMCEKIEGACQAPPEFNFVEYTC
DEGYGVGAVCYPTCIVALSDPVVLASNSTADTLKHWVLPTKVQSIVCTGTMSWHPNPEQI
HCIQSCEPFAGDGWCDTINNRAYCQYDGGDCCPSTLSTRKVIQFGVDCDHDECTCRDPEA
EENRGKAERVEQAESGAV
Download sequence
Identical sequences XP_017573919.1.86671

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]