SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017653734.1.79516 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017653734.1.79516
Domain Number 1 Region: 180-237
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.22e-26
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 2 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-24
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 3 Region: 124-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-23
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 4 Region: 265-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.18e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 432-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.36e-21
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 6 Region: 544-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.43e-21
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 7 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.02e-20
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 8 Region: 76-125
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.75e-20
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 9 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.99e-20
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 10 Region: 2-58
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.7e-19
Family KRAB domain (Kruppel-associated box) 0.0023
Further Details:      
 
Domain Number 11 Region: 586-638
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000101
Family Classic zinc finger, C2H2 0.013
Further Details:      
 
Domain Number 12 Region: 227-259
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000323
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017653734.1.79516
Sequence length 646
Comment PREDICTED: LOW QUALITY PROTEIN: zinc finger protein 420-like, partial [Nannospalax galili]; AA=GCF_000622305.1; RF=representative genome; TAX=1026970; STAX=1026970; NAME=Nannospalax galili; AL=Scaffold; RT=Major
Sequence
KPLSFSDVAIDFSPEESECLNPAQWKLYKDVMLENYSNLVLLGLAFSKPSLVTFLEQRKE
PWDVKTQVTLAIHTGLTHQRIHTDEKPFKCEECDKSFMWVSYLRAHKRIHTGEKPXRCEE
CGRAFTGNSTLRKHYRMHTGEKPYKCEECGKSFSQIPHLRTHQRIHTDEKPFKCEECDKS
FMWVSYLRVHQRIHTGEKPYRCEECGKAFGTRSALSIHQRIHTGEKPYRCEECGKAFISN
SALNAHKKRHTGAKSFECEECGKRFYSASVLKQHGRIHSGEKPYKCEECGRCFGDHSNLS
KHKRIHTGEKPYRCEECGKAFTSNSSLTWHKIRHTAHKPYKCEECGKSFYFPSALKHHQR
NHSGENPYGCEECGKAFRTHSKLSEHKRIHTGEKPYKCNECGKAFVTHSTLSKHKRIHTG
EKPYECEECGKTFGTRSILFKHRRIHTGEKPYKCEECGNAFAHNYSLTKHKVIHTGDFPY
KCDECGKNFYFPLALSRHQRIHSGEESYPCDKCDKMFYSTTKLRKHQRIHSEEKPYKCKE
CGKAFKRSTLLRQHQRVHTGEKPFRCQECDKSFTTVSGVTQHKVVHTGQRPYKCEECNKT
FCYISSLTRHQKVHSREKVCMCEFCGKVFANSTGLSHHKRVHRNFK
Download sequence
Identical sequences XP_017653734.1.79516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]