SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017682528.1.3805 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017682528.1.3805
Domain Number 1 Region: 38-557
Classification Level Classification E-value
Superfamily Sema domain 2.49e-97
Family Sema domain 0.0015
Further Details:      
 
Domain Number 2 Region: 1428-1553,1719-1876
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 4.32e-36
Family p120GAP domain-like 0.021
Further Details:      
 
Domain Number 3 Region: 901-981
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000165
Family Other IPT/TIG domains 0.015
Further Details:      
 
Domain Number 4 Region: 991-1081
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000242
Family Other IPT/TIG domains 0.052
Further Details:      
 
Domain Number 5 Region: 560-612
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000262
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 1080-1164
Classification Level Classification E-value
Superfamily E set domains 0.00000000306
Family E-set domains of sugar-utilizing enzymes 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017682528.1.3805
Sequence length 1943
Comment PREDICTED: plexin-D1 [Lepidothrix coronata]; AA=GCF_001604755.1; RF=representative genome; TAX=321398; STAX=321398; NAME=Lepidothrix coronata; AL=Scaffold; RT=Major
Sequence
MAPAPVPAAGAELRPPALLPLLLLPLLLPDRAAGLEVQRKFLSPTPTNNFALDGPGSRVY
LAAVNRLFQLSGGELALEAEAAVGPVLDSPLCHAPQLPQASCEHPRVLTNNYNKILQPDP
EQGVLVVCGSIYQGLCQLRSMANISAVASMLNGLCPPGGSDSVTVFPSMLNVAANHPNAS
TVGLVLRRGGGGGARLLVAATYTGFGSPFFPRNRSLEDHRFENTPEIAIRALNARGDLAK
LFTFDINPSDDNILKIKQGDKARHKLSFVRAFLQRGAAPRARRPYAYLALNSEANAGDKE
SPAHSLLARICLGEPAEATLNGSGETKKLTESYIQLGLRCGGAADAFTRLVSVFPARAAW
RSPAAPPGPAPAPPPPEELLFGVFERAGAGGAGGRPQSALCVFRFAEIEETIRAARNSCF
VSPAAGMVTVLDSVVQGTGPACEKRNIQLQPEQLDCGAAHLQHPLAIVNPVTATPIFTYS
GLTAVAVASVNNYTVVFLGTASGGLLKINLDTTMKVISRRSISVAYGEPVHPIMQFDPSD
PTYLYLMTSYQMTRVKVAACSQYSTCTDCLAAADAYCGWCTMETRCSLQHECTNSTGANF
WASASEGVQQCPSMTILEPEINIDKENPALIIQINGTIPNLNGTNISCDYGNNIHTVARV
AGDYVNQFIYCSLLPREKYPAFPDDQDHVVVETALRVNSKNIIQANFTIYDCKRTGNIYP
KRACTSCLSARWKCHWCPSTYTCVSNHSQCDNALQMKKKIDCPRIVPAPLEPMPTGVSRD
ITISLANATFSKETALECHFGTDRTFEARWVNSSAVECVRVLLHTSEKSHHFPVNLQLKD
RPDRFIDSPEMMTVEVYNCGTGSADCSQCLGREDVGHRCLWSESSSSCRLHTEPPQVSDV
CPAPEIRKIEPLRGPLEGGTLLTIRGRNLGRRFSDVLAAVWVGSVHCTPLPDRYIVSEMI
VCQTGEAQETFSDVVTVNVSREGRSRERYSYVLPLVQSIAPSNGPKAGGTRVTIRGSRLD
VGSELRVLINSSKQCTDLSRTDSTITCTMPAAELTTAVPVCVQFENKSCVSLNITFKYEK
NPVISDINPKKSQISGGRIITLEGRGFELVQNVSMAVRGIGREHTCCRVHTDTTITCPSP
AASNITVGSKPAPVDFYLNGRLYTDDRPALDEEMYPEEALHFSKFSLEYYADPQFSTAKK
EKWIKHHPGEPLTLVIHKEPDSLGLESNEYQVKIGLISCEIQIVSDKVIHCSVNESLSTS
ERQLPVTIQVGKFNYTIAMLHLGGGETAIIVSIVICSILLVLSVVALFVFCTKSRRAERY
WQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKC
SSLYEECYVLPSQQLSSQVGSQVQETHPLLVGEWKIPENCRPNMEEGISLFSTLLNNKHF
LIVFVHALEQQKDFAVRDRCNLASLLTIALHGKLEYYTSIMKDLLVDLIDASASKNPKLM
LRRTESVVEKMLTNWMSICMYSYLRETVGEPFFLLICAIKQQINKGSIDAITGKARYTLN
EEWLLRENIEAKPRNLNVSFQGCGMDSLSVRAMDTDTLSQVKEKILEAFCKNVPYSQWPR
VEDVDLEWFATSTDSYILRDLDDTSVVEDGRKKLNTLAHYKIPEGASLAMSLSDKKDTTL
SRVKDLDTEKYFHLVLPTDESVEHKKSHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLF
KAILSIRDDKPPVAVKYFFDFLEEQAEKRGITDPDTLHIWKTNSLPLRFWVNILKNPQFV
FDIDKTDHIDACLSVIAQAFIDACSLSDLQLGKDSPTNKLLYAKEIPEYRKIVQRYYKQI
HDMSPLSEQEMNAHLAEESRKYRNEFNTNVAMAEIYKYAKRYRSQIVAALDANPTTKRTQ
LQHKFEQVIALMEDNIYECCSEA
Download sequence
Identical sequences XP_017682528.1.3805

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]