SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017704208.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017704208.1.44346
Domain Number 1 Region: 524-743
Classification Level Classification E-value
Superfamily Bet v1-like 5.56e-40
Family STAR domain 0.005
Further Details:      
 
Domain Number 2 Region: 124-243
Classification Level Classification E-value
Superfamily PH domain-like 8.99e-27
Family Pleckstrin-homology domain (PH domain) 0.0039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017704208.1.44346
Sequence length 752
Comment PREDICTED: collagen type IV alpha-3-binding protein isoform X1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MQHSGIPIPPSPYCAPPTFLPLVIRESRGGLSSGGSTGRNAGVPETAAAADGWKGRLPSS
LVLLPRSARCQARRRRGERTSSLLLLPPTPELALFASPFPDPSPRGLGASSGAVEGAGAG
LLLGCRASMSDNQSWNSSGSEEDPETESGPPVERCGVLSKWTNYIHGWQDRWVVLKNNAL
SYYKSEDETEYGCRGSICLSKAVITPHDFDECRFDISVNDSVWYLRAQDPDHRQQWIDAI
EQHKTESGYGSESSLRRHGSMVSLVSGASGYSATSTSSFKKGHSLREKLAEMETFRDILC
RQVDTLQKYFDACADAVSKDELQRDKVVEDDEDDFPTTRSDGDFLHNTNGNKEKLFPHVT
PKGINGIDFKGEAITFKATTAGILATLSHCIELMVKREDSWQKRLDKETEKKRRTEEAYK
NAMTELKKKSHFGGPDYEEGPNSLINEEEFFDAVEAALDRQDKIEEQSQSEKVRLHWPTS
LPSGDAFSSVGTHRFVQKPYSRSSSMSSIDLVSASDDVHRFSSQVEEMVQNHMTYSLQDV
GGDANWQLVVEEGEMKVYRREVEENGIVLDPLKATHAVKGVTGHEVCNYFWNVDVRNDWE
TTIENFHVVETLADNAIIIYQTHKRVWPASQRDVLYLSAIRKISALTENDPETWIVCNFS
VDHDSAPLNNRCVRAKINVAMICQTLVSPPEGNQEISRDNILCKITYVANVNPGGWAPAS
VLRAVAKREYPKFLKRFTSYVQEKTAGKPILF
Download sequence
Identical sequences A0A2K6MXC8 A0A2K6P281
XP_017704207.1.44346 XP_017704208.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]