SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017717931.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017717931.1.44346
Domain Number 1 Region: 2210-2303
Classification Level Classification E-value
Superfamily C-type lectin-like 1.83e-33
Family Link domain 0.00012
Further Details:      
 
Domain Number 2 Region: 506-644
Classification Level Classification E-value
Superfamily FAS1 domain 2.49e-29
Family FAS1 domain 0.0016
Further Details:      
 
Domain Number 3 Region: 1471-1519,1600-1711
Classification Level Classification E-value
Superfamily FAS1 domain 3.53e-28
Family FAS1 domain 0.003
Further Details:      
 
Domain Number 4 Region: 383-496
Classification Level Classification E-value
Superfamily FAS1 domain 3.27e-21
Family FAS1 domain 0.0037
Further Details:      
 
Domain Number 5 Region: 2301-2464
Classification Level Classification E-value
Superfamily FAS1 domain 1.57e-17
Family FAS1 domain 0.0095
Further Details:      
 
Domain Number 6 Region: 1713-1869
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000000183
Family FAS1 domain 0.0065
Further Details:      
 
Domain Number 7 Region: 962-1099
Classification Level Classification E-value
Superfamily FAS1 domain 0.00000000000732
Family FAS1 domain 0.011
Further Details:      
 
Domain Number 8 Region: 1110-1232
Classification Level Classification E-value
Superfamily FAS1 domain 0.000000000719
Family FAS1 domain 0.0079
Further Details:      
 
Domain Number 9 Region: 1543-1580
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000191
Family Merozoite surface protein 1 (MSP-1) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017717931.1.44346
Sequence length 2572
Comment PREDICTED: LOW QUALITY PROTEIN: stabilin-1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MAGPQGLLPLCFLAFCLAVFIRGQVLFKGCDVKTTFVTHVPCTSCAAIKKQTCPSGWLRE
LPDQITQDCRYEVQLGGSMVSMSGCRRKCRKQVVQKACCPGYWGSRCYECPGGAETPCNG
HGTCLDGMDRNGTCVCQENFRGSACQECQDPNRFGPDCQSVCSCVHGVCNHGPRGDGSCL
CFAGYTGPHCDQELPICQELRCPQNTQCSAEAPSCRCLPGYTQQGSECRAPNPCWPSPCS
PLAQCSVSPKGQAQCHCPENYHGDGMVCLPKDPCTDNLGGCPSNSTLCVYQKPGQAFCTC
RPGLISINNNASAGCFPFCSPFSCDRSATCKATADGKTSCVCRESEVGDGRACYGHLLHE
VQKATQTGRVFLQLRVAVAMMDQGCREILTTAGPFTVLVPSISSFSSRTMNASLAQQLCR
QHIIAGQHILEDTRTQQTRRWWTLAGQEITVTFNQFTKYSYKYKDQPQQTFNIYKANNIA
ANGVFHVVTGLRWQPPSGTPGDPKRTIGQILASTEAFSRFETILENCGLPSILDGPGPFT
VFAPSNEAVDSLRDGRLIYLFTAGLSKLQELVRYHIYNHGQLTVEKLILQRSXSTMANQV
LAVNISEEGRILLGPEGVPLQRVDVLAANGVIHMLDGILLPPTILPILPKHCSEEQHKIV
AGSCVDCQALNTSMCPHNSVKLDIFPKECVYIHDPTGLNVLKKGCASYCNQTVTEQGCCK
GFFGPDCTQCPGGFSNPCYGKGNCSDGIQGNGACLCFPDYKGIACHICSNPNKHGDQCQE
DCGCVHGLCDNRPGSGGVCQQGTCAPGFSGRFCNESMGDCGPTGLAQHCHLHARCVSQEG
VARCRCLDGFEGDGFSCTPSNPCSHPDRGGCSENAECVPGSLGTHHCTCHKGWSGDGRVC
VAIDECELDVRGGCHADALCSYVGPGQSRCTCKLGFAGDGYQCSPIDPCRAGNGGCHGLA
TCRAVGGGQRVCTCPPGFGGDGFSCYGDIFWELEANAHFSVFYQWFKSAGITLPADRQVT
ALVPSEAAVRQLNPEERAFWLQPRMLPSLVRAHFLQGALFEEELARLGGQEVATLNPTTR
WEIRNISGRVWWQNAACEGQXLCXRRCPFFATDQVLTAPPRDDAQWGRGLLQQLDLVPAF
SLFRELLQRHRLVSQIEAATAYTIFVPTNRSLEAQGNSSHLDADTVRHHVVLGEALSMET
LRKGGHRNSLLGPAHWIVFYNHSGQPEVNHVPLEGPMLEAPGRSLIGLSGVLTVGSSRCL
HSHAEALREKCVNCTRKFRCTQGFQLQDTPRKSCVYRSGFSFSRGCSYTCAKKIQVPDCC
PGFFGTLCEPCPGGLGGVCSGHGQCQDRFLGSGECHCHEGFHGTACEMCELGRYGPNCTG
VCDCAHGLCQEGLQGDGSCVCNVGWQGLRCDQKITSPQCPRKCDPNANCVQDSAGASTCA
CAAGYSGNGVFCSEVDPCAHGHGGCSPHANCTKVAPGQRTCTCQDGYMGDGELCQEINSC
LIHHGGCHIHAECIPTGPQQVSCSCRQGYSGDGIRTCELLDPCSKNNGGCSPYATCKSTG
DGQRTCTCDTANTVGDGLTCRARVGLELLRDKHASFFSLRLLEYKELKGDGPFTIFVPHA
DLMSNLSQDELARIRAHRQLVFRYHVVGCRRLRSEDLLEQGYATALSGHPLRFSEREGSI
YLNDFARVVSSDHEAVNGILHFIDRVLLPPDALHWEPDDEPIPRRNVTAAAQGFGYKIFS
SLLKVLGPARCPCXPEASHRPFTSVPHQTPAAFRALPPDRQAWLYHEDHRDKLAAILRGH
MIRNVEALASDLPNLGPLRTMHGTPVSFSCSRTRPGELMVGEDDARIVQRHLPFEGGLAY
GIDQLLEPPGLGARCDHFETRPLRLNTCSICGLEPPCPEGSQEQGSPEACWRFYPKFWTS
PPLRSLGLRSVWVQHSLWARPQGLGRGCHRNCVTTTWKPSCCPGHYGSECQACPGGPSSP
CSDRGMCMDGMSGSGQCLCHSGFAGTACELCAPGAFGPHCQACRCTVHGRCDEGLGGSGS
CFCDEGWTGSHCEVQLELQPVCTPPCAPKAVCRAGNSCECSLGYEGDGRVCTVADLCQDG
HGGCSEHANCSQVGTAVTCTCLPDYEGDGWSCRARNPCTDGHRGGCSEHADCLSTGLNTR
RCECHAGYVGDGLQCLEELEPPVDRCLGQPPPCHSDAVCTDLHFQEKRAGVFHLQATSGP
YGLNFSEAEAACKAQGAVLASFPQLSAAQQLGFHLCLMGWLANGSAAHPVVFPVADCGNG
RVGIVSLGARKNLSERWDAYCFRVQDVACRCRDGFVGDGISTCNGKLLDVLAATANFSTF
YGMLLGYANATQRGLDFLDFLDDELTYKTLFVPVNEGFVDNMTLSGPDLELHASNATLLS
ANASQGKLLPAHSGLSLIISDAGPDNSSWAPVAPGTVVVSHVIVWDIMAFNGIIHVLASP
LLAPPQPQAVLAPEAPPVAAGVGAVLAAGALLGLVAGALYLRARVKPTGFGFSAFQAEED
AADDFSPWQEGTNPTLVSVPNPVFGSDTFCEPFNDSLLEEDFPDTQRILTVK
Download sequence
Identical sequences XP_017717931.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]