SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017722820.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017722820.1.44346
Domain Number 1 Region: 53-234
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.55e-44
Family Ankyrin repeat 0.00031
Further Details:      
 
Domain Number 2 Region: 275-338
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.0000000114
Family SAM (sterile alpha motif) domain 0.019
Further Details:      
 
Domain Number 3 Region: 245-300,385-420
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000418
Family Pseudo ankyrin repeat 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017722820.1.44346
Sequence length 475
Comment PREDICTED: ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MAAGALCGLPVAGGGESSESEDDGWEIGYLDRTSQKLKGLLPIEEKKEKFKKAMTIGDVS
LIQELLDSGISVDSTFQYGWTPLMYAASVANAELVRVLLDRGANASFEKDKQTILITACS
AHGSEEQILKCVELLLSRNADPNVACRRLMTPIMYAARDGHTQVVALLVAHGAEVNTQDE
NGYTALTWAARQGHKNIVLKLLELGANKVLQTKDGKMPSEIAKRNKHHEIFNLLSFTLNP
LEGKLQQLTKEDTICKILTTDSDREKDHIFSSYTAFGDLEVFLHGIGLEHMTDLLKERDI
TLRHLLTMREDEFTKNGITSKDQQKILAALKELQVEEIQFGELSEEIKLEISGDEFLNFL
LKLNKQCGHLITAVQNIITELPVNSQKITLEWASPRNFTSVCEELVNNVENLSEEVCKLK
DLIQKLQNERENDPTHIQLREEVSTWNRRILKRTAMTVCGFGFLLFICKLTFQRK
Download sequence
Identical sequences A0A2K6K5B5 A0A2K6R665
XP_010387636.1.97406 XP_017722820.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]