SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017727234.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017727234.1.44346
Domain Number 1 Region: 280-376
Classification Level Classification E-value
Superfamily Immunoglobulin 9.09e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 439-730
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000109
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.038
Further Details:      
 
Domain Number 3 Region: 25-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000152
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 4 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000956
Family I set domains 0.082
Further Details:      
 
Domain Number 5 Region: 125-197
Classification Level Classification E-value
Superfamily EF-hand 0.00000000106
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017727234.1.44346
Sequence length 792
Comment PREDICTED: follistatin-related protein 5 isoform X1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MIQDGPFGSCENKYCGLGRHCVIGRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVH
RAACLKKEKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYVMQENENPNDDDISR
KKLLVDQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYDLLKYDDFNADKHLAL
EEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLE
DINDFGDDGSLYITKVTTTHMGNYTCYADGYEHVYQTHSFQVNVPPVIRVYPESQAREPG
VTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIA
KNEAGVDEDISSLFVEDSARKTLANILWREEGLGIGNMFYVFYEDGIKVIQPIECEFQRH
IKPSEKLLGFQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVV
QAVSTDPVPVKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQF
DRVDDYFIPTTTLIITHMRFGFVLHKDEAALQKMDLETMSYIKTINLKDYKCVPQSLAYT
HLGGYYFIGCKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGL
VRVQYITIRGEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGK
VKMIKSLKEPLKAEEWPWNQKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEV
EKGNTVIWVGDA
Download sequence
Identical sequences XP_010374721.1.97406 XP_017727234.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]