SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017727239.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017727239.1.44346
Domain Number 1 Region: 280-376
Classification Level Classification E-value
Superfamily Immunoglobulin 8.95e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 2 Region: 430-721
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.0000000000000106
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.038
Further Details:      
 
Domain Number 3 Region: 25-78
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000000152
Family Ovomucoid domain III-like 0.0097
Further Details:      
 
Domain Number 4 Region: 201-292
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000942
Family I set domains 0.082
Further Details:      
 
Domain Number 5 Region: 125-197
Classification Level Classification E-value
Superfamily EF-hand 0.00000000105
Family Calmodulin-like 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017727239.1.44346
Sequence length 783
Comment PREDICTED: follistatin-related protein 5 isoform X2 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MIQDGPFGSCENKYCGLGRHCVIGRETGQAECACMDLCKRHYKPVCGSDGEFYENHCEVH
RAACLKKEKITIVHNEDCFFKGDKCKTTEYSKMKNMLLDLQNQKYVMQENENPNDDDISR
KKLLVDQMFKYFDADSNGLVDINELTQVIKQEELGKDLFDCTLYDLLKYDDFNADKHLAL
EEFYRAFQVIQLSLPEDQKLSITAATVGQSAVLSCAIQGTLRPPIIWKRNNIILNNLDLE
DINDFGDDGSLYITKVTTTHMGNYTCYADGYEHVYQTHSFQVNVPPVIRVYPESQAREPG
VTASLRCHAEGIPKPQLGWLKNGIDITPKLSKQLTLQANGSEVHISNVRYEDTGAYTCIA
KNEAGVDEDISSLFVEDSARKTRLGIGNMFYVFYEDGIKVIQPIECEFQRHIKPSEKLLG
FQDEVCPKAEGDEVQRCVWASAVNVKDKFIYVAQPTLDRVLIVDVQSQKVVQAVSTDPVP
VKLHYDKSHDQVWVLSWGTLEKTSPTLQVITLASGNVPHHTIHTQPVGKQFDRVDDYFIP
TTTLIITHMRFGFVLHKDEAALQKMDLETMSYIKTINLKDYKCVPQSLAYTHLGGYYFIG
CKPDSTGAVSPQVMVDGVTDSVIGFNSDVTGTPYVSPDGHYLVSINDVKGLVRVQYITIR
GEIQEAFDIHTNLHISDLAFQPSFTEAHQYNIYGSSSTQTDVLFVELSSGKVKMIKSLKE
PLKAEEWPWNQKNRQIQDSGLFGQYLMTPSKDSLFILDGRLNKLNCEITEVEKGNTVIWV
GDA
Download sequence
Identical sequences XP_010374722.1.97406 XP_017727239.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]