SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017729249.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017729249.1.44346
Domain Number 1 Region: 25-314
Classification Level Classification E-value
Superfamily RCC1/BLIP-II 3.23e-81
Family Regulator of chromosome condensation RCC1 0.016
Further Details:      
 
Domain Number 2 Region: 355-465
Classification Level Classification E-value
Superfamily POZ domain 4.32e-25
Family BTB/POZ domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017729249.1.44346
Sequence length 531
Comment PREDICTED: RCC1 and BTB domain-containing protein 1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MVDVGKWPIFTLLSPQEIASIRKACVFGTSASEALYVTDDDEVFVFGLNYSNCLGTGDNQ
STLVPKKLEGLSGKKIKSLSYGSGPHVLLSTEDGVVYAWGHNGYSQLGNGTTNQGIAPIQ
VCTNLLIKQVVEVACGSHHSMALAADGEVFAWGYNNCGQVGSGSTANQPTPRKVTNCLHI
KRVVGIACGQTSSMAVLDNGEVYGWGYNGNGQLGLGNNGNQLTPVRVAALHSVCVNQIVC
GYAHTLALTDEGLLYAWGANTYGQLGTGNKNNLLSPAHIMVEKERVVEIAACHSAHTSAA
KTQGGHVYMWGQCRGQSVILPHLTHFSCTDDVFACFATPAVSWRLLSVEHEDFLTVAESL
KKEFDSPETADLKFRIDGKYIHVHKAVLKIRCEHFRSMFQSYWNEDMKEVIEIDQFSYPV
YRAFLQYLYTDTVDLPPEDAIGLLDLATSYCENRLKKLCQHIIKRGITVENAFSLFSAAV
RYDAEDLEEFCFKFCINHLTEVTQTAAFWQMDGPLLKEFIAKASKCGAFKN
Download sequence
Identical sequences A0A096N8C1 A0A0D9RYP4 A0A1D5QZ86 A0A2K5HSM7 A0A2K5NQU6 A0A2K5YB63 A0A2K6BWA2 A0A2K6L9Y6 A0A2K6QG98 G7PVF0
NP_001247543.1.72884 XP_005585916.1.63531 XP_005585917.1.63531 XP_005585918.1.63531 XP_007958600.1.81039 XP_007958601.1.81039 XP_007958602.1.81039 XP_007958603.1.81039 XP_010362133.1.97406 XP_010362134.1.97406 XP_011754900.1.29376 XP_011754901.1.29376 XP_011754902.1.29376 XP_011754903.1.29376 XP_011794766.1.43180 XP_011794772.1.43180 XP_011844173.1.47321 XP_011844174.1.47321 XP_011919642.1.92194 XP_011919643.1.92194 XP_011919645.1.92194 XP_011919646.1.92194 XP_014976390.1.72884 XP_014976391.1.72884 XP_015294776.1.63531 XP_017729248.1.44346 XP_017729249.1.44346 XP_017729250.1.44346 XP_017729251.1.44346 ENSPANP00000008848 9544.ENSMMUP00000027673 ENSMMUP00000027673 ENSMMUP00000027673

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]