SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017732889.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017732889.1.44346
Domain Number 1 Region: 372-560
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.08e-37
Family Nucleotide and nucleoside kinases 0.000000965
Further Details:      
 
Domain Number 2 Region: 130-318
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.22e-32
Family Nucleotide and nucleoside kinases 0.0000468
Further Details:      
 
Domain Number 3 Region: 4-46
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017732889.1.44346
Sequence length 562
Comment PREDICTED: adenylate kinase isoenzyme 5 isoform X1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MNTNDAKEYLARREIPQLFESLLNGLMCSKPEDPVEYLESCLQKVKELGGCDKVKWDTFV
SQEKKTLPPLNGGQSRRSFLRNVMPENSNFPYRRYDRLPPIHQFSIESDTDLSETAELIE
EYEVFDPTRPRPKIILVIGGPGSGKGTQSLKIAERYGFKYISVGELLRKKIHSTSSNRKW
SLIAKIITTGELAPQETTITEIKQKLMQIPDEEGIVIDGFPRDVAQALSFEDQICTPDLV
VFLACANQRLKERLLKRAEQQGRPDDNVKATQRRLMNFKQNAAPLVKYFQEKGLIMTFDA
DRDEDEVFYDISMAVDNKLFPNKEAAAGSSDLDPSMILDTGEIIDTGSDYEDQGDDQLNV
FGEDTMGGFMEDLRKCKIIFMIGGPGSGKGTQCEKLVEKYGFTHLSTGELLRKELASESE
RSKLIRDIMERGDLVPSGIVLELLKEAMVASLGDTRGFLIDGYPREVKQGEEFGRRIGDP
HLVICMDCSADTMTNRLLQRSQSSLPADDTTKTIAKRLEAYYRASIPVIAYYETKTQLHK
INAEGTPEDVFLQLCTAIDSIF
Download sequence
Identical sequences A0A2K6L8T1
XP_017732889.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]