SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017742901.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017742901.1.44346
Domain Number 1 Region: 34-266
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.22e-85
Family Calponin-homology domain, CH-domain 0.0000169
Further Details:      
 
Domain Number 2 Region: 286-408
Classification Level Classification E-value
Superfamily Spectrin repeat 4.32e-35
Family Spectrin repeat 0.00000061
Further Details:      
 
Domain Number 3 Region: 522-640
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-29
Family Spectrin repeat 0.0000058
Further Details:      
 
Domain Number 4 Region: 409-517
Classification Level Classification E-value
Superfamily Spectrin repeat 4.45e-25
Family Spectrin repeat 0.0000036
Further Details:      
 
Domain Number 5 Region: 646-758
Classification Level Classification E-value
Superfamily Spectrin repeat 1.87e-23
Family Spectrin repeat 0.00000287
Further Details:      
 
Domain Number 6 Region: 751-883
Classification Level Classification E-value
Superfamily EF-hand 1.18e-22
Family EF-hand modules in multidomain proteins 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_017742901.1.44346
Sequence length 911
Comment PREDICTED: alpha-actinin-4 isoform X1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MVDYHAANQSYQYGPSSAGNGAGGGGSMGDYMAQEDDWDRDLLLDPAWEKQQRKTFTAWC
NSHLRKAGTQIENIDEDFRDGLKLMLLLEVISGERLPKPERGKMRVHKINNVNKALDFIA
SKGVKLVSIGAEEIVDGNAKMTLGMIWTIILRFAIQDISVEETSAKEGLLLWCQRKTAPY
KNVNVQNFHISWKDGLAFNALIHRHRPELIEYDKLRKDDPVTNLNNAFEVAEKYLDIPKM
LDAEDIVNTARPDEKAIMTYVSSFYHAFSGAQKAETAANRICKVLAVNQENEHLMEDYEK
LASDLLEWIRRTIPWLEDRVPQKTIQEMQQKLEDFRDYRRVHKPPKVQEKCQLEINFNTL
QTKLRLSNRPAFMPSEGKMVSDINNGWQHLEQAEKGYEEWLLNEIRRLERLDHLAEKFRQ
KASIHEAWTDGKEAMLKHRDYETATLSDIKALIRKHEAFESDLAAHQDRVEQIAAIAQEL
NELDYYDSHNVNTRCQKICDQWDALGSLTHSRREALEKTEKQLEAIDQLHLEYAKRAAPF
NNWMESAMEDLQDMFIVHTIEEIEGLISAHDQFKSTLPDADREREAILAIHKEAQRIAES
NHIKLSGSNPYTTVTPQIINSKWEKVQQLVPKRDHALLEEQSKQQSNEHLRRQFASQANV
VGPWIQTKMEEIGRISIEMNGTLEDQLSHLKQYERSIVDYKPNLDLLEQQHQLIQEALIF
DNKHTNYTMEHIRVGWEQLLTTIARTINEVENQILTRDAKGISQEQMQEFRASFNHFDKD
HGGALGPEEFKACLISLGYDVENDRQGEAEFNRIMSLVDPNHSGLVTFQAFIDFMSRETT
DTDTADQVIASFKVLAGDKNFITAEELRRELPPDQAEYCIARMAPYQGPDAVPGALDYKS
FSTALYGESDL
Download sequence
Identical sequences A0A0D9QVJ0 A0A0S2Z3G9 A0A2I2YSG9 A0A2K5JXA8 A0A2K5LEJ8 A0A2K5TSS4 A0A2K6CAX8 A0A2K6ME12 A0A2K6RRL9 F7HU82 H2QG89 O43707
ENSPTRP00000018747 9544.ENSMMUP00000008470 9606.ENSP00000252699 ENSPTRP00000018747 gi|12025678|ref|NP_004915.2| ENSMMUP00000008470 ENSP00000252699 ENSP00000252699 ENSMMUP00000008470 NP_001248731.1.72884 NP_004915.2.87134 NP_004915.2.92137 XP_003954421.1.37143 XP_005589184.1.63531 XP_007994903.1.81039 XP_010384031.1.97406 XP_011763171.1.29376 XP_011807783.1.43180 XP_011933926.1.92194 XP_017742901.1.44346 XP_018871027.1.27298 ENSPANP00000000771 ENSP00000252699

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]