SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017747185.1.44346 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017747185.1.44346
Domain Number 1 Region: 263-437
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 3.35e-28
Family Laminin G-like module 0.072
Further Details:      
 
Domain Number 2 Region: 682-829
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.0000000000267
Family Serralysin-like metalloprotease, catalytic (N-terminal) domain 0.09
Further Details:      
 
Domain Number 3 Region: 1524-1598
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.000000000139
Family Complement control module/SCR domain 0.0019
Further Details:      
 
Domain Number 4 Region: 1590-1647
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.00000806
Family Complement control module/SCR domain 0.0065
Further Details:      
 
Domain Number 5 Region: 540-640,720-771
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 0.00000816
Family Reprolysin-like 0.067
Further Details:      
 
Domain Number 6 Region: 1480-1530
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0000361
Family Complement control module/SCR domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017747185.1.44346
Sequence length 1791
Comment PREDICTED: pappalysin-2 isoform X1 [Rhinopithecus bieti]; AA=GCF_001698545.1; RF=representative genome; TAX=61621; STAX=61621; NAME=Rhinopithecus bieti; AL=Scaffold; RT=Major
Sequence
MMCLKILRISLAILAGWALCSANSELGWTRKKSLVEREHLNQVLLEGERCWLGAKVRRPR
ASPQHHLFGVYPSRAGNYLRPYPVEEQEIHHTGRSRPDTKGNAVNLVPRDLTENPAGLRG
AVEQPAAPWVGNSPTGQSELLGGDDTYLGNQGSKESLGEAGTQKGSAVAATTATTIFTTP
KEPKPETQRRGWTKSRQHRQVWKRRAEDVWGDSDISSHFQPWSKHSLKHRVRKSLPDKSN
QNGGEDPYREAETFNSQVGLPILYFSGRRERLLLRPEVLAEIPREAFTVEAWVKPEGGQN
NPAIIAGVFDNCSHTVSDKGWALGIRSGQDKGKRDARFFFSLRTDRMKKATILISHSRYQ
PGTWTHVAATYDGRRMALYVHGTQVASSLDQSGPLNSPFMASCRSLLLGGDSSEDGRYFR
GHLGTLVFWSTALPQNHFQHSSQHSSGEEEATDLVLTASFEPLNTEWVPFRDEKYPRLEV
LQGFEPEPEILSPLRPPLCGQTVCDNVELISRYNGYWPLRGEKVIRYQVVNICDDEGLNP
IVSEEQIRLQHEALNEAFSRYNISWQLSVHQVHNSTLRHRVVLVNCEPSKIGNDHCDPEC
EHPLTGYDGGDCRLQGRCYSWNRRDGLCHAECNNMLNDFDDGDCCDPQVADVRKTCFDPD
SPKRAYMSVKELKEALQLNSTHFLNIYFASSVREDLAGAATWPWDKDAVTHLGGIVLSPG
YYGMPGHTDTMIHEVGHVLGLYHVFKGVSERESCNDPCKETVPSMETGDLCADTAPTPKS
ELCREPEAMSDTCGFTRFPGAPFTNYMSYTDDNCTDNFTPNQVARMHCYLDLVYQQWTES
RKPTPIPIPPMIIGQTNKSLTIHWLPPLSGVVYDRASGSMCGACTEDGTFRQYVHTASSR
RVCDSSGYWTPEEAVGPPDVDQPCEPSLQAWSPEVHLYHMNMTVPCPTEGCSLELLFQYP
VQADTLTLWVTSFFLDSSQVLFDTEILLENKESVHLGPLDTFCDIPLTIKLHVDGKVSGV
KVYTFDERIEIDAALLTSQPHSPLCSGCRPVRYQVLRDPPFASGLPVVVTHLHRKFTDVE
VTPGQMYRYQVLAEAGGELGEASPPLNHIHGAPYCGDGKVSESLGEECDDGDLVSGDGCS
KACELEEGFNCVGEPSLCYMYEGDGICEPFERKTSIVDCGIYTPKGYLDQWATQAYSFHE
DKKKCPISLVTGEPHSLICTSYHPDLPNHRPLTGWFPCVASANETQDDRSEQPEGSLKKE
DEVWLKVCFNRPGVARAIFIFLTTDGLVPGEHRQPTVTLYLTDVRGSNHSLGTYGLSCQH
NPLIINVTHHQNILFHHTTSVLLNFSSPRVGISAVALRTFSHIGLSAPSNCISEDEGQNH
QGQSCVHQPCGKQDSCPSLLLDHADVVNCTSIGPGLMKCAITCQRGFALQASGGQYIRPM
QKEILLTCSSGHWDQNVSCLPVDCGVPNLSLVNYANFSCSEGTNFLKRCSISCVPPAKLQ
GLSPWLTCLEDGLWSLPEVYCKLECDAPPVILNANLLLPHCLQDNHDVGTICKYECKPGY
YVAESADGKVRNKFLKIQCLEGGIWEQGSCIPVVCEPPPPVFEGMYECTNGFNLDSQCVL
NCNQESEKLPILCTKEGLWTQEFKLCENLQGECPPPPSELNSVEYKCEQGYGIGAVCSPL
CVIPPSDPVMLPENVTADTLEHWMEPVKVQSIVCTGRRQWHPDPILVHCIQSCEPFQADG
WCDTINNRAYCHYDGGDCCSSTLSSKKVIPFAADCDLDECTCRDPKAEENQ
Download sequence
Identical sequences A0A2K6MTE2
XP_017747185.1.44346

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]