SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_017761350.1.86738 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017761350.1.86738
Domain Number 1 Region: 573-633
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 317-368
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000001
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 144-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000106
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 4 Region: 490-541
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000116
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 627-688
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000443
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 544-599
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000182
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 432-483
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000207
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017761350.1.86738
Sequence length 1091
Comment PREDICTED: zinc finger protein 91-like [Eufriesea mexicana]; AA=GCF_001483705.1; RF=representative genome; TAX=516756; STAX=516756; NAME=Eufriesea mexicana; AL=Scaffold; RT=Major
Sequence
MDVAGDLTLQWVEEVGNVIHEEVICGLEAQLVGAEEEVIGACEEVAVEETVESVPNVTST
TESEILMVPQSNDMESIYIVPQDQGHDYLNIQVTEEVIADNWDRSGPEDGVEIPEAKVSH
ENLLEYDDMEIPLPIDQDSYTNSRPYPCDFCSRRFRKKANLMNHMVAHQTDRPHGCNLCG
ARYARKCDLMNHLKIHAYAPSRDGLEDDLNDDDSFAPEEEESTKGRRKKMQSSIPRKRKN
NSAISKRNMEDNKMEMGKYINKSYDYVDEDMRLLEEMTSRNSARSSNYASSSRWTEQMSP
VSTEHQAPRWPITDPTKPYVCQYCGVGFAREKALASHARIHGGDSPFECTSCGDMFWDVN
SLREHVRIKHGGTVQSDTEEYDNDATYTGDERFGEFYCNTCGVPFHRLDLLKRHQKIHVK
QEADMVEGPSQHHVCNVCGEWFEEALALLAHAELHARSPSRRCLLCGERCRDDAEVAEHV
RQHHAEDAPPNTCTLCGKTCKDKRSLLKHSWVHNVDKTFGCTKCGKRFHSKARLRRHMVS
HRNKMVACDECGEEFPDGRALVSHRHSHNKDLGGRSFPCRECGKTFGSRSSQQIHIRIHT
GERPYGCRFCWKAFADGGTLRKHERIHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPD
PKCVGSITPYLCKVCGDAYGTSEEIVAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKPHE
TSTMLRMTEQYDMLEGGSDSDDNTKRKLGRKNKQHRSNVEEGYQNVLKSFESSLQNINSI
VSNSKLNPGKSKLSKKKLKKEEKRSEGQTSCQPGRPKMIHTQKTRVPVEIGSDGVKKGQK
TKTMVTRTPKMMPQEHKLGIFPGGERNRPRTKNVSYHIEGKLQPTSATFPKPKEEIPTPP
IPARHQSPLASIKIEPNLQKTSNNNHRNNNGNILAINNEKMESTPRKKSGVLRRIKKQKE
EIKQEPMDIDHEEIQNNNNTENTDSERLMDHTIDGSNLEVAFEASVTTEEEHLLPDVGGV
NISEEVATGNVKLSVKVESTPQRMLAVHSVIAPVDDIPETIIPDAVEYTCEMCSAVFSSR
AELLVHVPIHI
Download sequence
Identical sequences XP_017761350.1.86738

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]