SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017786877.1.89798 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017786877.1.89798
Domain Number 1 Region: 641-766
Classification Level Classification E-value
Superfamily Bromodomain 1.7e-30
Family Bromodomain 0.00075
Further Details:      
 
Domain Number 2 Region: 514-635
Classification Level Classification E-value
Superfamily Bromodomain 4.71e-30
Family Bromodomain 0.0005
Further Details:      
 
Domain Number 3 Region: 240-327
Classification Level Classification E-value
Superfamily Bromodomain 5.23e-27
Family Bromodomain 0.00082
Further Details:      
 
Domain Number 4 Region: 395-494
Classification Level Classification E-value
Superfamily Bromodomain 4.71e-26
Family Bromodomain 0.0013
Further Details:      
 
Domain Number 5 Region: 48-176
Classification Level Classification E-value
Superfamily Bromodomain 1.14e-24
Family Bromodomain 0.0017
Further Details:      
 
Domain Number 6 Region: 1351-1416
Classification Level Classification E-value
Superfamily HMG-box 0.0000000000000301
Family HMG-box 0.0019
Further Details:      
 
Domain Number 7 Region: 822-886
Classification Level Classification E-value
Superfamily Bromodomain 0.00000000103
Family Bromodomain 0.0068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_017786877.1.89798
Sequence length 1693
Comment PREDICTED: protein polybromo-1 [Nicrophorus vespilloides]; AA=GCF_001412225.1; RF=representative genome; TAX=110193; STAX=110193; NAME=Nicrophorus vespilloides; AL=Scaffold; RT=Major
Sequence
MRLRPSVQLQRLAAKPHCNDTNAKVRMSKRRRTSSIASRGQEEDSLDSIEASSSSGPSSR
KRMKKQDPMELVQQIYDSIRNYKKEDGTLLCDAFIRVPKRRQEPRYYEVVSNPIDLLKVQ
QKLKTDEYEDIDDLQIDIDLIVSNAIAFYKKNSQEFKDACDLWELFLVNKARIYDGKDDD
AEKSKALLRVARAQRKAMTPESRIMKNEVDISEDTSESSTNPDEEFNVYEDLFTAIMTAT
DAENHPLHIDFQLLPSKRKYPEYYEVIENPIDLKTIAVKIQSNEYSTLNDMEKDLLQMTK
NACTFNEPGSQIYKNAKALKKIITSKKIEVEHGKYQGGKSSERIRNKRMRASTSLSAVTA
ALHDESEMELEPDESMEEDVGVVDSDNPKWQLFDTVKSVTTNSGGSLSEPFWRLPSRRVY
PDYYREIKNPVCMMQIRRKLVCQSYGTVSEVAGDMTIMFENAKKYNLPSSKLYKDAVKLQ
KVMQSKVQELLDLDQDTDNEETDNRKKGGIKVKTPSTPAPRGRPAKDVIPLKRRLHSLAK
FLLDYSKEDGRKPLMGFMEKPSKKLYPDYYQVITEPIDFLEIEAKIKGEQYSSENELVRD
FKLMFSNCRTYNEENSHIYEDATLLEKVLIEKIGQTIVTPERKTYSRVARPKRILTPIDR
NCRTLYDTIKDYREPKANRQLSLIFMKLPSKSDYPDYYELIKSPVDMEKISHKVKSKEYD
TLEDLVSEFNMMFDNACKYNEPDSQIYKDALVLQKICLQTKLQLKEDDDTVPDVPAAIQD
LLLSLFTSIYNHQDVDERCYSDSMSDLPEHDDIDGKKVRALSLDLIKRRLDKGLYRRLDT
FQDDFFACLERARQLSRSDSQVFEDSIEMQTFFIKLRDELCRNGELLHSPALNYSLMNLQ
TSVETVRQSKQLQESLDDENETRSSDDSIIKDSLNIGETMTFNQRTFKVGDFVYLDAKEK
GVDPHILLIERLWSNGGQKMLYGNYYLRPAETYHLTTRKFLEKEVFKSDTHVAVPLEDIK
ERCCVINFKQYFIMKPEGFDEKDVYVCECRYSTKSRSFKRIKLFPESPNMVLVPRETPME
PKRVVSIFRERVEKHKDELAELQEIERLVEKEKPNVIAFSQMELDDGNTYFEQYNTICSG
VVKTGDFVYVAADGGRQTIAQIDSIYETKDGKCYFRGPWFVLPSEMLQIPNRSYYRQEMF
LSTLEEVNPIVSVVGKCTVLDYNEYISSRPTEIPEVDVYICTSLYDEINRQLQKLPLDGL
KKYHHSSGVTEDEIYYFPKLINPLKVGNEPQLMEAPAKAQATILEVESSPMLTKLNDMDI
LMEDSIDGPPSVGSGELPATVPISGSSISTPATTKKKNKNKVITGYILYSREVRKTVVAN
NPNSSFGEISRIVGNEWKSLSTTEKIAWEEKASKQNDETKARFLEEGDSCNSPAPSTHPD
HIFECCWDTCDYQFEESSDCIEHCIRDKDGGGGHVQTYFSQNPEAELHCLWRGCARIKNK
KNSQPFPNVTRLVRHVRDLHINKGNGRVVPMENRSKNFIGNRVMPVLQPCVSTTVEIISA
ASNTFNTSGTFATSTTPGIRSALNNKTTPAPAVVPQKQHEPLFISVPPRPQRALHSEAYI
KYIEGLHADNKYISPWEKTLNASQENAVPDMEKINNASTWLGTKANQQDNVLNALWALRN
QLLRDTLGLQKTL
Download sequence
Identical sequences XP_017786877.1.89798

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]