SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_017788658.1.86229 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_017788658.1.86229
Domain Number 1 Region: 550-608
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.25e-16
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 146-198
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000902
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 292-343
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000924
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 4 Region: 465-516
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000104
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 5 Region: 602-663
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000434
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 519-574
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000162
Family Classic zinc finger, C2H2 0.018
Further Details:      
 
Domain Number 7 Region: 406-451
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000357
Family Classic zinc finger, C2H2 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_017788658.1.86229
Sequence length 1066
Comment PREDICTED: zinc finger protein 234-like [Habropoda laboriosa]; AA=GCF_001263275.1; RF=representative genome; TAX=597456; STAX=597456; NAME=Habropoda laboriosa; AL=Scaffold; RT=Major
Sequence
MKMDVTGDLTLQWVEEVGNVIHEEVIYGLEAQLVGAEEEVIGACEEVAVEETVESVPNVA
PSTESEILMVPQTNDMESIYIVPQDQGHDYLNIQVTEEVIADSWDRSGPEDGVEISETKV
SHENLLEYDDMEIPLPIDLDSYTNSRPYPCDFCSRRFRKKANLMNHMVSHQTDRPHGCNL
CGARYARKCDLMNHLKIHAYAPSRDGLEDDLNDDDSLAPEEEESTKGRRKKVQSSVPRKR
KNNSIIPKRSMEDNKMEMGNGNYASSSRWNDQMSPVSTEPQAPRWPITDPTKPYVCQYCG
VGFAREKALASHARIHGGDSPFECTSCGDMFWDVNSLREHVRIKHGGTIQSDTEEYDNDA
TYTGDERFGEFYCNTCGVPFHRLDLLKRHQKIHVKQESDMVEGPSQHHVCNVCGEWFEEA
LALLAHAELHARSPSRRCLLCGERCRDDAEVAEHVRQNHADDAPPNTCTLCGKTCKDKRS
LLKHSWVHNVDKTFGCTKCGKRFHSKARLRRHMVSHRNKMVACDECGEEFPDGRALVSHR
YSHNKDLRGRSFPCRECGKTFGSRSSQQIHIRIHTGERPYGCRFCWKAFADGGTLRKHER
IHTGEKPYGCAICPRAFNQRVVLREHVRAHHSGPDPKCVGSITPYLCKVCGDAYGTSEEI
VAHIVQHCDDNTALRRQPQTGPRKYKRRRKLKSHETNTMLRMSEQYDMMEGGTDSDDNTK
RKLGRKNKQHRSNVEEGYQNVLKSFESSLQNINSIVSNSKLNPGKSKLSKKKLRKEEKKN
EAQASCQPGRPKMIHTQKTRVPVEIGSDGVKKGQKTKTMVTRTPKMMPQEHKIGVFPGGE
RNRPRTKNVSYHIEGKLQPAPATFPKPKEEPPSTPTSIHQPLPLTSIKIEPNLQNTQNNN
HRNNNGNILGINNEKIELTPRKKSGVLKKIKKQRDGIKQEPMDIDQDEMQNNNNTENPDS
DRLMDHTVDGSNLEVAFEASVTTEEEIILPHVDEINNTEDMGTGNVKLSVKVESTPERML
AVHGVITPVDDIPETIIPDAVEYTCEMCSAVFSSRAELLVHVPIHI
Download sequence
Identical sequences XP_017788658.1.86229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]